Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus CP gene for coat protein, complete cds, isolate:yo.

ACC No: AB044705

Dated: 2005-04-14 | Length: 1173 | CRC: 1614528452

                !!NA_SEQUENCE 1.0
ID   AB044705   standard; genomic RNA; VRL; 1173 BP.
XX
AC   AB044705;
XX
SV   AB044705.1
XX
DT   21-DEC-2000 (Rel. 66, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Melon necrotic spot virus CP gene for coat protein, complete cds,
DE   isolate:yo.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1173
RA   Oyama M., Hanada K., Sakai J.;
RT   ;
RL   Submitted (14-JUN-2000) to the EMBL/GenBank/DDBJ databases.
RL   Maki Oyama, KYOWASEED CO.,LTD., chonan research station; 377 chonan-machi
RL   ozawa, chosei, chiba 297-0142, Japan (E-mail:oyama@kqc.kyowaseed.co.jp,
RL   Tel:81-475-46-0212, Fax:81-475-46-1107)
XX
RN   [2]
RA   Oyama M., Sakai J., Aihara H., Hanada K.;
RT   "Comparison of nucleotide sequence of coat protein gene of six MNSV
RT   isolates found in West Japan";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1173
FT                   /country="Japan:Okinawa"
FT                   /db_xref="taxon:11987"
FT                   /mol_type="genomic RNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="yo"
FT   CDS             1. .1173
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DTZ6"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9DTZ6"
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="BAB19654.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISFTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIFHREFI
FT                   ASVLPSNDLTVNNGDTNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRVTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSSPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 1173 BP; 267 A; 268 C; 273 G; 365 T; 0 other;

 AB044705  Length: 1173  April 19, 2005 08:50  Type: N  Check: 716  ..

       1  atggcgatgg ttaaacgcat taataattta ccaacagtga agcttgctaa
      51  gcaggccctg cccctgctaa cgaatcctaa aattgtgaat aaggccatag
     101  atgtggttcc tttggtcgtc cagggtggtc agaaattgtc caaggctgcc
     151  aagcggttgc ttggcgccta tggtggtaat atttctttca ctgagggcgc
     201  taagcctggt gctatatccg ctccagttgc cattagtagg cgagtggcgg
     251  ggatgaagcc taggtttgtt cgttccgaag gatctgtgaa gatatttcat
     301  agggagttta ttgcctctgt tcttccgtcg aatgatctca ccgtgaacaa
     351  tggtgatacc aatatcggta agtatagggt caatcccagt aataacgctt
     401  tattcacatg gcttcaggga caagcgcaat tatatgatat gtacagattt
     451  actcgacttc gagttaccta tattccaact accggatcca cttccacagg
     501  tcgtgtttct attctttggg atagagattc tcaggatccc ctccctattg
     551  accgcgccgc cattagttct tatgctcatt acgcagattc atcgccttgg
     601  gcagagaatg ttttagtggt tccgtgtgac aatacgtgga ggtatatgaa
     651  tgatactaat gcagtggacc ggaagttggt tgactttggg cagtttctct
     701  ttgctactta ttctggtgct ggtgccaccg cccatggtga tctctacgtt
     751  gagtacgctg ttgaatttaa agatccccag ccgattgccg gaatggtgtg
     801  tatgtttgat cgcttggtct ctttctctga agtcggatct acaattaaag
     851  gagtcaatta tattgctgat cgtgatgtga taactactgg gggtaatatt
     901  ggtgtcaaca tcaatattcc cgggacttat ctcgtcacga ttgttcttaa
     951  tgccacatca attggctccc tcaccttcac tggtaattct aaacttgtag
    1001  gcaatagtct caacgttacc agcagtggtg cttctgctct cacgttcacc
    1051  cttaactcca ctggtgtgcc caacagttcc aattcttcat tctctgtggg
    1101  tactgtcgtt gcattgacta gggtccgtat gacgatcact cgctgctctc
    1151  ctgaaactgc ctacctcgcc taa