Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus CP gene for coat protein, complete cds, isolate:ta.

ACC No: AB044706

Dated: 2005-04-14 | Length: 1173 | CRC: 1400304369

                !!NA_SEQUENCE 1.0
ID   AB044706   standard; genomic RNA; VRL; 1173 BP.
XX
AC   AB044706;
XX
SV   AB044706.1
XX
DT   21-DEC-2000 (Rel. 66, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Melon necrotic spot virus CP gene for coat protein, complete cds,
DE   isolate:ta.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1173
RA   Oyama M., Hanada K., Sakai J.;
RT   ;
RL   Submitted (14-JUN-2000) to the EMBL/GenBank/DDBJ databases.
RL   Maki Oyama, KYOWASEED CO.,LTD., chonan research station; 377 chonan-machi
RL   ozawa, chosei, chiba 297-0142, Japan (E-mail:oyama@kqc.kyowaseed.co.jp,
RL   Tel:81-475-46-0212, Fax:81-475-46-1107)
XX
RN   [2]
RA   Oyama M., Sakai J., Aihara H., Hanada K.;
RT   "Comparison of nucleotide sequence of coat protein gene of six MNSV
RT   isolates found in West Japan";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1173
FT                   /country="Japan:shiga"
FT                   /db_xref="taxon:11987"
FT                   /mol_type="genomic RNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="ta"
FT   CDS             1. .1173
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9DTZ5"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9DTZ5"
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="BAB19655.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSINSSFSVGTIVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 1173 BP; 274 A; 271 C; 268 G; 360 T; 0 other;

 AB044706  Length: 1173  April 19, 2005 08:50  Type: N  Check: 9613  ..

       1  atggcgatgg ttaaacgcat taataattta ccaacagtga agcttgctaa
      51  gcaggccctg cccctgctca cgaatcctaa aattgtgaat aaggctatag
     101  atgtggttcc tttggtcgtc caaggtggtc agaaattgtc caaagctgcc
     151  aagcggttgc ttggcgctta tggtggtaat atttcttaca ctgagggcgc
     201  taagcctggt gcaatatccg ccccagttgc cattagtagg cgagtggcgg
     251  gtatgaagcc taggtttgtt cgatccgaag gatctgtgaa gatagttcac
     301  agggagttta ttgcctctgt tcttccgtcg aatgatctca ccgtgaataa
     351  tggtgatgtc aacatcggta agtacagggt caatcccagt aataacgctt
     401  tattcacatg gcttcaggga caagcgcaat tatatgatat gtacagattt
     451  actcgacttc gatttaccta tattccaact accggatcca cttccacagg
     501  tcgtgtttct attctctggg atagagactc tcaggatccc ctccctattg
     551  accgcgccgc tattagttct tatgctcatt acgctgattc agcgccttgg
     601  gcagagaacg ttttagtggt tccgtgtgac aatacgtgga ggtatatgaa
     651  tgataccaat gcagtggacc ggaagttggt cgattttggg cagtttctct
     701  ttgctactta ttctggtgct ggtgccaccg cccatggtga tctctatgtt
     751  gagtatgctg tcgaattcaa agatccccag ccaattgctg gaatggtttg
     801  tatgtttgat cgcttggtct ctttctctga agtcggatct acaattaaag
     851  gagtcaatta cattgctgat cgtgatgtga taactactgg gggtaatatt
     901  ggtgttaaca tcaatattcc cgggacttat ctcgtcacga ttgttcttaa
     951  tgccacatca attggctccc tcaccttcac tggcaattcc aaactcgtag
    1001  gcaatagtct taacgttacc agcagtggcg cttctgctct tacattcacc
    1051  cttaactcta ctggggtgcc caacagtatc aattcttcat tctctgtggg
    1101  cactatcgtt gcattaacta gggttcgtat gacgatcact cgctgctctc
    1151  ctgaaactgc ctacctcgcc taa