Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus gene for coat protein, complete cds.

ACC No: AB106106

Dated: 2009-01-18 | Length: 1173 | CRC: -363485671

                
ID   AB106106; SV 1; linear; genomic RNA; STD; VRL; 1173 BP.
XX
AC   AB106106;
XX
DT   02-APR-2003 (Rel. 75, Created)
DT   18-JAN-2009 (Rel. 99, Last updated, Version 4)
XX
DE   Melon necrotic spot virus gene for coat protein, complete cds.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1173
RA   Choi G.;
RT   ;
RL   Submitted (17-MAR-2003) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Gug-seoun Choi NHRI, Horticultural enviloment; Top-dong, Suwon
RL   441-440, Korea
XX
RN   [2]
RA   Choi G.;
RT   "Characterization of MNSV isolated from muskmelon";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1173
FT                   /organism="Melon necrotic spot virus"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="muskmelon"
FT                   /db_xref="taxon:11987"
FT   CDS             1. .1173
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q80MJ4"
FT                   /db_xref="HSSP:P11795"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q80MJ4"
FT                   /protein_id="BAC66449.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYKFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSTPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVPINIPGTYLVTIVLNATSIGSLSFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSTNSSFSVGTVVALTRVRMAITRCSPETAYLA"
XX
SQ   Sequence 1173 BP; 274 A; 273 C; 267 G; 359 T; 0 other;

ab106106 Length: 1173  18-JAN-2009  Type: N  Check: 274  ..

       1  atggcgatgg ttaaacgcat taataattta ccaacagtga agcttgctaa
      51  gcaggccctg cccctgctaa cgaatcctaa aattgtgaat aaagctatag
     101  atgtggttcc tttggtcgtc caaggtggtc agaaattgtc caaggctgcc
     151  aagcggttgc ttggtgctta tggtggtaat atttcttaca ctgagggcgc
     201  taagccaggt gcaatatccg ctccagttgc cattagtagg cgagtggcgg
     251  gtatgaagcc taggtttgtt cgatccgaag gatctgtgaa gatagttcat
     301  agggagttta ttgcctctgt ccttccgtcg aatgatctca ccgtgaataa
     351  tggtgatgtc aatatcggta agtatagggt caatcctagt aataatgctt
     401  tatttacatg gcttcaggga caagcacaat tatatgatat gtacaaattc
     451  actcggcttc gattcaccta cattccaact accggatcta cttccacagg
     501  tcgtgtctct attctctggg atagagactc acaggatccc cttcctattg
     551  accgcgctgc cattagttct tatgctcatt acgctgattc aacgccttgg
     601  gcagagaacg ttctagtggt cccgtgtgac aatacatgga ggtacatgaa
     651  tgataccaat gcagtggacc ggaagttggt cgattttggg cagttcctct
     701  ttgctactta ttctggcgct ggtgccaccg cccatggtga tctctacgtt
     751  gaatacgccg ttgaattcaa agatccccag cctattgctg gaatggtttg
     801  tatgtttgat cgcttggtct ctttctctga agttggatct acaattaaag
     851  gagttaatta tattgccgat cgtgatgtga taaccaccgg gggcaatatt
     901  ggtgttccta tcaatattcc cgggacttat ctcgtcacga ttgttcttaa
     951  cgctacatcg attggctccc tctccttcac tggcaattct aaactcgtag
    1001  gcaatagtct caacgttacc agtagtggtg cttccgctct tacatttacc
    1051  cttaattcca ctggtgtgcc caacagtacc aattcttctt tttctgtggg
    1101  caccgttgtt gcattgacta gggtacgtat ggcgatcact cgctgctcac
    1151  ctgaaaccgc ctacctcgcc taa