Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus CP gene for coat protein, complete cds, isolate: Yamaguchi.

ACC No: AB189944

Dated: 2009-10-08 | Length: 4270 | CRC: 1585191850

                
ID   AB189944; SV 1; linear; genomic RNA; STD; VRL; 4270 BP.
XX
AC   AB189944;
XX
DT   28-SEP-2005 (Rel. 85, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Melon necrotic spot virus CP gene for coat protein, complete cds, isolate:
DE   Yamaguchi.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4270
RA   Omura T.;
RT   ;
RL   Submitted (06-SEP-2004) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Toshihiro Omura National Agricultural Research Center, Laboratory
RL   of Virology; Kannondai, Tsukuba, Ibaraki 305-8666, Japan
XX
RN   [2]
RA   Kubo C., Nakazono-Nagaoka E., Hagiwara K., Kajihara H., Takeuchi S.,
RA   Matsuo K., Ichiki T.U., Omura T.;
RT   "New severe strains of Melon necrotic spot virus: symptomatology and
RT   sequencing";
RL   Plant Pathol. 54:615-620(2005).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4270
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="Yamaguchi"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:11987"
FT   CDS             2817. .3989
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q3LHM0"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LHM0"
FT                   /protein_id="BAE45293.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDTNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRVTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYVHYADSSPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGTGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVSIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 4270 BP; 1067 A; 877 C; 1072 G; 1254 T; 0 other;

ab189944 Length: 4270  08-OCT-2009  Type: N  Check: 5379  ..

       1  gggattactc tagccgaatc cccgactttc ttggtttctg tgagttagtt
      51  cgtatattgg ttgtctgtct taatcaatac aggttagcaa tggatactgg
     101  tttgaaattt cttgtttctg gaggtttagc cacctcatct gttatcagga
     151  aagtgagtgc tgtgagttca ttggattcgt cccttccttc atcgtctata
     201  ctatctgcca ttcatgggtc ttggactagt gctatcagcc acgattgtag
     251  caagatcgcc aaggttgcca ccgtaattgg aattggttat cttggggttc
     301  ggattggtgc cgcatggtgt cgtcgtaccc ccgggatagc gaactctata
     351  attacatatg gggaagaagt ggttgagcaa gtaaaggtgg atattgatga
     401  agatgctgaa gaggagtccg ataccggtga ggaaattgtg gttggcacga
     451  taggtattgg tatacacact aacgtcaacc ctgaagttcg agctaagcgt
     501  agacatagat cgaggccatt cattaagaaa attgtgaatt tgacgaaaaa
     551  tcactttggt ggatgtcccg attcaagtaa atcgaacgtc atggctgtta
     601  gcaaatttgt ttatgaacaa tgtaaacagc acaattgtct tccacatcag
     651  acgagattga tcatgagtgt tgcagttcca ttggtgttaa gtcccgacat
     701  gtacgacatt tccagtaaag ctctgttaaa cagcgagata ttaacagaga
     751  acagagccac actggaccgc ctcaaaactc ttgatgggtg gctgtcacat
     801  ttagtgtgcc acccccttag cgcgaaggct tggaggcggg cgattgacaa
     851  cttgtgtggt cttcctgatt ggaaggcctt caagttggtc aactaggggt
     901  gcctagagga actcgctggg ttctgtactt cggtacggag agggacgcac
     951  ccagacatga ccgagtttcc tcaggatcgt cccattaaga cacgcaaact
    1001  gtattgtttg gggggagttg gaactagcgt gaagttcaat gtgcacaata
    1051  actctctagc caaccttcgg cgcggtctca tagaacgcgt tttctttgtt
    1101  gaaaatgata agaaggaact agagcctgcc cctaaacccc ttagtggtgt
    1151  gtttgatcgc ttaatctggt ttcgtcggaa actccataat attgtgggta
    1201  ctcattccag tattagtcca ggtcaattct tggattttta tactggcagg
    1251  aggcgtacaa tttatgaagg tgccgtgaag tcattggagg ggttaagtgt
    1301  tcaaagaagg gatgcctatt tgaaaacgtt tgttaaggcg gagaagatta
    1351  acaccactag gaagcctgac ccagctccgc gggtcataca accgaggaac
    1401  gtaagatata atgttgaggt tggtcgttat ctacgtaggt ttgagcatta
    1451  cctctatcga ggaattgatg aaatctggaa tggccccacg ataattaaag
    1501  gatacactgt cgagcaaatt gggaaaatcg ctcgcgatgc ttgggactct
    1551  ttcgtgagcc ccgtggcaat cgggtttgat atgaagaggt tcgaccaaca
    1601  tgtatcctcc gacgctctta aatgggaaca tagtgtttat cttgatgctt
    1651  tttgccatga ttcttatctt gcagaattgt tggagtggca attagtcaat
    1701  aagggagtcg ggtatgccag tgatggaatg atcaaatata aggttgatgg
    1751  gtgccggatg agtggtgata tgaatacagc tatgggtaac tgtctgattg
    1801  cctgtgccat cacacatgat ttcttccgta gtcgtggcat cagggcgcgt
    1851  ttgatgaaca atggtgatga ctgtgtcgta atgtgcgaaa aagaatgtgc
    1901  cgcggtggtt aaagccgaca tggtaaggca ctggagacaa ttcgggtttc
    1951  aatgtgagct cgaatgcgac gcagaagtct tcgagcaaat tgagttttgt
    2001  caaatgcggc ctgtgtacga cggggaaaaa tatgtgatgg tgcggaatcc
    2051  gttagttagt ctgtctaaag attcatactc agtcggccca tggaatggaa
    2101  tcaaccatgc acgcaagtgg gttaatgctg ttggcttgtg tggcttatcc
    2151  ctcactggtg gaattcctgt tgtccaaagt tactataata tgatgattcg
    2201  taacactcag tccgtgaaca gttctggcat tctccgggat gtcagttttg
    2251  ctagtggatt tcgggagtta gcgcgattgg gtaacaggaa aagtggtgct
    2301  atatcagaag acgcccgttt tagcttttat ctcgcatttg gcattactcc
    2351  agatttacaa cgtgccatgg aaagtgacta tgatgctcat accatagagt
    2401  ggggtttcgt gccccaggga aatcctagaa tacagccaat ctcatggacc
    2451  ctcaacgaac tgtagaacaa actaatcctc ggggaagaag taaagaacgt
    2501  ggtgacagcg ggggaaaaca gaagaactca atggggcgaa agatagccaa
    2551  tgatgctatc tctgaatcga agcagggagt tatgggtgct agcacataca
    2601  tcgctgataa aattaaggta actatcaact ttaattttta gtgtatggct
    2651  tgttaccgtt gtgactccag ccccggggat tactctggag ctctgcttat
    2701  attatttatc tcatttgttt tcttctatat tacctcgctt agcccgcaag
    2751  gaaatactta cgtacaccac ttcgataatt cttccgttaa gacgcaatac
    2801  gttggcatct ctacaaatgg cgatggttaa acgcattaat aatttaccaa
    2851  cagtgaagct tgctaagcag gctctgcccc tgctaacgaa tcctaaaatt
    2901  gtgaataagg ccatagatgt ggttcctttg gtcgtccagg gtggtcagaa
    2951  attgtccaaa gctgccaagc ggttgcttgg cgcttatggt ggtaacattt
    3001  cttacactga gggcgccaag cctggtgcta tatccgctcc agttgccatt
    3051  agtaggcgag tggcggggat gaagcctagg tttgttcgat ccgaaggatc
    3101  tgtgaagata gttcataggg agtttattgc ctctgttctt ccgtcgaatg
    3151  atctcaccgt gaacaatggt gataccaata tcggtaagta cagggtcaat
    3201  cccagtaata acgctttatt cacatggctt cagggacaag cgcaattata
    3251  tgatatgtac agatttactc ggcttcgagt tacctatatt ccaactaccg
    3301  gatccacttc cacaggtcgt gtttctatcc tttgggatag agactctcag
    3351  gatccccttc ctattgaccg cgccgctatt agttcttatg ttcattacgc
    3401  agattcatcg ccttgggcag agaacgtttt agtggttcca tgtgacaata
    3451  cgtggaggta tatgaatgat actaatgcag tggaccggaa gttggttgat
    3501  tttgggcagt ttctctttgc cacttattct ggtactggtg ccaccgccca
    3551  tggtgatctc tacgttgagt acgctgttga attcaaagat ccccagccga
    3601  tcgctggaat ggtgtgtatg tttgatcgct tggtctcttt ctctgaagtc
    3651  ggatctacaa ttaaaggagt caattatatt gctgatcgtg atgtaataac
    3701  tacggggggt aatattggtg tcaacatcaa tattcccggg acttatctcg
    3751  tctcgattgt tcttaatgcc acatcaattg gctccctcac cttcactggt
    3801  aattctaaac ttgtaggcaa tagtcttaac gttaccagca gtggtgcttc
    3851  tgctcttaca tttaccctta actccactgg tgtgcccaac agttccaatt
    3901  cttcattctc tgtgggcact gttgttgcat tgactagggt ccgtatgacg
    3951  atcactcgct gctctcctga aactgcctac ctcgcctaga ttaaatttac
    4001  tatactccaa atctggtctc tcttatacct acctgttctc agccagatct
    4051  ctgttctggt gtcctatagg tgtccttgtc gtgtgtagtg cggtctggct
    4101  aaccgtaacg gcgtatcggc ttggttctcc gacgattagg ctccgggatg
    4151  tacgacatag ttgaagatgg atggtgtttg gtagatcacc gctagcaaaa
    4201  tacactctgt gtggggcgtg ctagtggata gtcatgtatg tttgagatgg
    4251  gttataggcc catcccgccc