Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus genomic RNA, complete genome, isolate: Tottori.

ACC No: AB232925

Dated: 2011-05-17 | Length: 4261 | CRC: 908947721

                
ID   AB232925; SV 1; linear; genomic RNA; STD; VRL; 4261 BP.
XX
AC   AB232925;
XX
DT   19-MAR-2008 (Rel. 95, Created)
DT   17-MAY-2011 (Rel. 108, Last updated, Version 4)
XX
DE   Melon necrotic spot virus genomic RNA, complete genome, isolate: Tottori.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4261
RA   Ohki T., Sako I., Takeuchi S., Tsuda S., Honda Y.;
RT   ;
RL   Submitted (25-AUG-2005) to the INSDC.
RL   Contact:Takehiro Ohki National agricultural research center, Department of
RL   Plant Pathology; Kan-nondai, Tsukuba, Ibaraki 305-8666, Japan
XX
RN   [2]
RA   Ohki T., Sako I., Kanda A., Mochizuki T., Honda Y., Tsuda S.;
RT   "A New Strain of Melon necrotic spot virus that Is Unable to Systemically
RT   Infect Cucumis melo";
RL   Phytopathology 11:1165-1170(2008).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4261
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="Tottori"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="watermelon"
FT                   /note="Melon necrotic spot virus watermelon strain Tottori
FT                   isolate"
FT                   /db_xref="taxon:11987"
FT   CDS             94. .2469
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /transl_except=(pos:898. .900,aa:OTHER)
FT                   /gene="p89"
FT                   /product="89K protein"
FT                   /note="Putative RNA-dependent RNA polymerase produced by a
FT                   readthrouth of the amber codon; replicase"
FT                   /db_xref="GOA:B1B1S7"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1S7"
FT                   /protein_id="BAG13029.1"
FT                   /translation="METGLKFLVSGGLATSSVFRKVNAESLLDSSRASSDIIATVHGSM
FT                   INAVRDDCAKVAKVALCVGVAYAVWKAGSLWVRRRPVLRNAIVRGGEEVMEHITVGIDE
FT                   DEDSDAEDREEIIVGSIGIGVSRNVSPERKLKRRHRSKPFIRKIVHLTKNHFGGCPESS
FT                   KSNVMAVSKFVYDLCKQHNCLPHQTRMIISVTVPLVLSPDMYDISSRALLNSETLNENR
FT                   AKLDRLKTLDGWLSNLICHPLSAKAWRRTIDNLCGLPDWKAFRLINXGCLEELAGFCTS
FT                   VHRGTHPDMTEYPQERPVKTRKLFCLGGVGTSVQFNVHNNSMRNLRRGLMERVFYVENE
FT                   KKELEPAPKPLDGVFGNLAWFRRKLHNIVGTHSCVSPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLGVQRRDAYLKTFVKAEKINTTRKPDPAPRVIQPRNVRYNVEVGRFLRRFEHYLYRG
FT                   IDEIWNGPTVIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSIPALQWEHSVY
FT                   LDAFCQDSYLAELLSWQLENKGVGYASDGMIRYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRCRGIRARLLNNGDDCVVIVEKECAAEVKSGMVRHWRQFGFQCELECDADIFEQIE
FT                   FCQMRPVYDGEKYIMVRNPLISLSKDAYSVGPWNSINHARKWVNAVGLCGMSLTGGIPV
FT                   VQSYYNMFIRNTKTVNSSSILRDVSFASGFRELAKLGNRSYRNISEESRFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIDWGFVPQGNPRIQPISWTLNAL"
FT   CDS             94. .900
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p29"
FT                   /product="29K protein"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1S8"
FT                   /protein_id="BAG13030.1"
FT                   /translation="METGLKFLVSGGLATSSVFRKVNAESLLDSSRASSDIIATVHGSM
FT                   INAVRDDCAKVAKVALCVGVAYAVWKAGSLWVRRRPVLRNAIVRGGEEVMEHITVGIDE
FT                   DEDSDAEDREEIIVGSIGIGVSRNVSPERKLKRRHRSKPFIRKIVHLTKNHFGGCPESS
FT                   KSNVMAVSKFVYDLCKQHNCLPHQTRMIISVTVPLVLSPDMYDISSRALLNSETLNENR
FT                   AKLDRLKTLDGWLSNLICHPLSAKAWRRTIDNLCGLPDWKAFRLIN"
FT   CDS             2448. .2645
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p7A"
FT                   /product="p7A protein"
FT                   /db_xref="GOA:B1B1T0"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1T0"
FT                   /protein_id="BAG13032.1"
FT                   /translation="MDPQRTVEQQNPRGRSRDRDDSGGKQKNSMGRKIANDAITESKQG
FT                   VMGASVYIADKIKVNINFNF"
FT   CDS             2649. .2834
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p7B"
FT                   /product="p7B protein"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1T1"
FT                   /protein_id="BAG13033.1"
FT                   /translation="MGCYRCDSGPGDYSGPLLILFLAFVFFYITSLGPHGNTYVHHFDN
FT                   SSVKTQYVGISTNGND"
FT   CDS             2821. .3993
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p42"
FT                   /product="capsid protein"
FT                   /db_xref="GOA:B1B1T2"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1T2"
FT                   /protein_id="BAG13034.1"
FT                   /translation="MAMIKRVNKLPTVQMAKQLLPLVPSAKLVNNAIDVVPLVVQGGKK
FT                   LSKAAKRLLGRYGGNITYTEGAKPGSVSAPVAISQRVAGMKPRFTQTAGSVKIVHRELI
FT                   TTVLPADSLTVNNGDTNTGKYRVNPSNNALFTWLQGQAQLYDMYRFTKLRFTYIPTTNT
FT                   TATGRVSVIWDKDSQDPLPQDRAAISSYAHYADSAPWAENYLVVPCDNVWRYMNDTNAV
FT                   DRKLVDVGQLIFATYSSVSSVPHGDLYVEYTVEFKEPQPISGMTCMFDRDVSLGPVGST
FT                   IRGSNYISDTNVVTSGGNVGVFLNVPGTYLVTLVINAVTVGGLTFPGNGRLIGSSLNVT
FT                   GGGATSLSFTVASTGVPNASAATFNVGSVVTPTRVRLTISRSSPETAYLA"
XX
SQ   Sequence 4261 BP; 1099 A; 892 C; 1068 G; 1202 T; 0 other;

ab232925 Length: 4261  17-MAY-2011  Type: N  Check: 2649  ..

       1  cggaaatctc tagccgattc cccgtgctct gtgcccgtcc tggcaagtct
      51  ttcaagatat tggcgaggtt aaccgtaata acgtaggcta gcaatggaaa
     101  ctggattgaa atttctcgtc tctggaggtt tagccacctc ttctgttttt
     151  cgcaaggtaa atgcagagag tttattggat tcgtcccgtg cttcatctga
     201  cattatagcc actgtgcatg gatcaatgat taatgccgtt cgtgacgatt
     251  gtgctaaagt ggccaaggtt gctctgtgtg ttggtgtggc ttacgcagtc
     301  tggaaagctg gatccctttg ggttcgtcgt cgaccagtcc tacggaacgc
     351  catagtgcgt ggtggagaag aagtcatgga gcatatcact gttggtattg
     401  atgaagatga agatagtgat gctgaagata gagaggaaat tattgttgga
     451  agcattggta tcggggtgag cagaaatgta tcccctgagc gcaaattgaa
     501  acgtagacac cgatctaagc ctttcattcg gaaaatcgtc cacttaacga
     551  aaaatcattt tggaggatgt cctgaatcta gcaaatcgaa tgtcatggct
     601  gtgagtaagt ttgtgtatga cttgtgtaag cagcataatt gccttccgca
     651  tcaaacgaga atgatcatca gcgttacagt tccattggtg ttgagtcccg
     701  acatgtatga tatatccagt agagctctat tgaacagcga gactcttaac
     751  gagaatagag ctaaactgga tcgcctcaaa acgttggatg gatggctctc
     801  caatcttata tgccatccac taagcgctaa ggcgtggagg cggacaattg
     851  acaatctatg cggtcttcct gattggaagg cctttaggtt gatcaactag
     901  gggtgcctag aggaactcgc tgggttttgc acgtctgtgc atagagggac
     951  acacccagac atgaccgagt atcctcagga acgtcccgtt aagacacgca
    1001  aactgttttg tttaggggga gtaggaacaa gcgtgcagtt caatgtgcat
    1051  aacaactcaa tgagaaatct tagaagaggt ctcatggaac gcgtatttta
    1101  cgttgaaaat gagaagaaag agttggaacc tgcccctaaa ccccttgatg
    1151  gtgtgtttgg taacctagct tggtttcgcc ggaaacttca taatattgtt
    1201  ggcactcatt cctgtgtatc gccgggtcag ttcctggatt tttacactgg
    1251  caggagacga accatatatg agggagccgt gaagtccttg gaagggctag
    1301  gggtccaacg tagagatgca tatcttaaaa cgtttgtcaa agccgaaaag
    1351  attaacacca caaggaaacc ggacccggct ccccgggtta tacaacctag
    1401  gaatgttcgt tataatgttg aggttggtcg attcttgaga aggtttgagc
    1451  attatctcta caggggaatt gatgaaattt ggaatggtcc tactgtgatt
    1501  aaaggatata ctgttgagca aatcgggaaa atcgcccgtg atgcttggga
    1551  ttcgttcgtg agtcccgtgg caatcgggtt tgacatgaag cgatttgacc
    1601  aacatgtatc catacccgct ctccaatggg aacacagcgt atatcttgat
    1651  gcgttctgtc aggatagtta tctcgcagag ttattatctt ggcagctcga
    1701  gaataaggga gtgggctacg ctagtgatgg gatgataaga tacaaggttg
    1751  atggttgtcg tatgagtggc gacatgaata ccgctatggg taattgccta
    1801  atagcctgcg ctatcacgca tgactttttc cgttgtcggg gtatacgggc
    1851  tcgtctgctt aataatggtg atgattgcgt cgtgatcgtc gagaaggaat
    1901  gtgccgcaga ggttaaatct ggcatggtaa ggcactggcg acagttcggg
    1951  ttccaatgtg agcttgaatg cgatgcagac atcttcgagc aaattgaatt
    2001  ttgtcagatg agacccgtgt acgatgggga aaaatacatc atggtgcgca
    2051  acccgctgat tagcttgtcc aaagatgcgt actctgtcgg cccttggaat
    2101  agcattaacc acgcacgcaa atgggtcaac gctgttggcc tgtgtggcat
    2151  gtccctaact ggtggtatac ctgttgtcca aagctattat aatatgttta
    2201  tccgtaatac caaaactgtc aatagctcta gcatcctccg tgatgtaagc
    2251  tttgccagtg ggtttaggga attagctaag ctgggaaaca ggtcatatag
    2301  gaacatatct gaggagtctc gatttagctt ttatctcgca tttggcatta
    2351  ctcctgactt gcaacgtgcc atggaaagtg actatgatgc tcataccatc
    2401  gattggggct ttgtgcccca gggaaatccc agaatacagc caatctcatg
    2451  gaccctcaac gcactgtaga acaacaaaat cctaggggca gaagtcgtga
    2501  tcgtgatgac agcgggggaa aacaaaagaa ttcaatgggg cgaaagatag
    2551  ccaatgacgc tatcacggaa tcgaagcagg gagtcatggg cgctagtgtc
    2601  tacatagcgg ataaaatcaa agtcaatatt aactttaatt tctaagctat
    2651  gggatgctat cgttgtgact ctggccccgg ggattactca ggtccactgc
    2701  ttatactctt ccttgcattc gtcttctttt atattacctc gcttggcccg
    2751  cacggtaata catacgttca tcatttcgat aactcttctg tcaaaactca
    2801  atacgttggc atctctacaa atggcaatga ttaaacgcgt caacaagctt
    2851  cccactgtcc agatggcaaa gcagcttctt ccgctggtgc catctgctaa
    2901  actcgtgaat aacgctatag atgtggttcc actggttgtc caaggtggta
    2951  agaagttatc taaagccgcc aagcgcttgc ttggcagata tggaggtaac
    3001  attacttaca ctgagggtgc gaaacctggg tccgtttctg ctcccgttgc
    3051  tattagtcag cgggttgccg gaatgaagcc caggtttacc caaacagctg
    3101  gatctgtgaa gatagtgcat agggaattga ttaccaccgt tttacctgct
    3151  gatagtctca ctgttaataa cggtgacact aacactggta agtatagagt
    3201  gaatccctct aataatgctt tattcacctg gttacaggga caagcacaac
    3251  tgtatgatat gtatagattc actaagctgc gatttacata tattccgact
    3301  accaacacga ctgcgacagg ccgcgtttct gtcatttggg ataaggattc
    3351  gcaagaccca ttgccccaag atagagccgc tattagcagt tatgctcact
    3401  acgctgactc agccccttgg gctgagaatt atttggtggt cccatgcgat
    3451  aatgtttgga ggtatatgaa tgacactaat gctgtggatc gcaagttggt
    3501  tgatgttggt caactgattt ttgctactta ctccagtgtc agttctgtcc
    3551  cccatggtga tctgtatgtt gaatatactg ttgaattcaa agaaccccaa
    3601  cccatttcag gcatgacgtg catgtttgac cgtgacgtgt ctcttggtcc
    3651  tgtcggttcg actattagag gatcaaatta cattagtgac accaacgttg
    3701  tcacctctgg tggtaacgtt ggagtattct tgaacgtccc gggaacttat
    3751  ttggttactc ttgttataaa tgccgtgact gttggtggtt taactttccc
    3801  tggcaatggc agacttattg gctcatctct caatgttaca ggtggtggcg
    3851  ccacttctct ttcatttacg gttgcaagta cgggtgttcc taacgcttca
    3901  gctgcaactt ttaatgttgg gtctgtggtc acgccaactc gagttcgttt
    3951  gactatatcc aggtcatcac ctgaaactgc ctatttagct tagaatactt
    4001  ccaaatttat ggatccttca tctagatcgt gttctctgga actgcatctg
    4051  cttttagttc ttgactcttc tcaaattgtg tagaatggac tggctaacca
    4101  ttacggcgta taagagagaa gggaatgatt gactaagggt gcacgaggcg
    4151  tcagaagatc gaactggagt ggggttaacg ccatctgcaa atacactctg
    4201  tgtggggcgg cagatggata gtcatgttac gattgaggag acttatcggg
    4251  tctccccgcc c