Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus genomic RNA, complete genome, isolate: Kochi.

ACC No: AB232926

Dated: 2011-05-17 | Length: 4261 | CRC: 672388898

                
ID   AB232926; SV 1; linear; genomic RNA; STD; VRL; 4261 BP.
XX
AC   AB232926;
XX
DT   19-MAR-2008 (Rel. 95, Created)
DT   17-MAY-2011 (Rel. 108, Last updated, Version 4)
XX
DE   Melon necrotic spot virus genomic RNA, complete genome, isolate: Kochi.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4261
RA   Ohki T., Sako I., Takeuchi S., Tsuda S., Honda Y.;
RT   ;
RL   Submitted (25-AUG-2005) to the INSDC.
RL   Contact:Takehiro Ohki National agricultural research center, Department of
RL   Plant Pathology; Kan-nondai, Tsukuba, Ibaraki 305-8666, Japan
XX
RN   [2]
RA   Ohki T., Sako I., Kanda A., Mochizuki T., Honda Y., Tsuda S.;
RT   "A New Strain of Melon necrotic spot virus that Is Unable to Systemically
RT   Infect Cucumis melo";
RL   Phytopathology 11:1165-1170(2008).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4261
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="Kochi"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="watermelon"
FT                   /note="Melon necrotic spot virus watermelon strain Kochi
FT                   isolate"
FT                   /db_xref="taxon:11987"
FT   CDS             94. .2469
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /transl_except=(pos:898. .900,aa:OTHER)
FT                   /gene="p89"
FT                   /product="89K protein"
FT                   /note="Putative RNA-dependent RNA polymerase produced by a
FT                   readthrouth of the amber codon; replicase"
FT                   /db_xref="GOA:B1B1T3"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1T3"
FT                   /protein_id="BAG13035.1"
FT                   /translation="METGLKFLVSGGLATSSVFRKVNAESLLDSSRASSDIIATVHGSM
FT                   INAVRDDCAKVAKVALCVGMAYAVWKAGSLWVRRRPVLRNAIVRGGEEVMEHITVGIDE
FT                   DEDSDAEDREEIIVGSIGIGVSRNVSPERKLKRRHRSKPFIRKIVHLTKNHFGGCPESS
FT                   KSNVMAVSKFVYDLCKQHNCLPHQTRMIISVAVPLVLSPDMYDISSRALLNSETLNENR
FT                   AKLDRLKTLDGWLSNLICHPLSAKAWRRTIDNLCGLPDWKAFRLINXGCLEELAGFCTS
FT                   VHRGTHPDMTEYPQERPVKTRKLFCLGGVGTSVQFNVHNNSMRNLRRGLMERVFYVENE
FT                   KKELEPAPKPLDGVFGNLAWFRRKLHNIVGTHSSISPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLGVQRRDAYLKTFVKAEKINTTRKPDPAPRVIQPRNVRYNVEVGRFLRRFEHYLYRG
FT                   IDEIWNGPTVIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSIPALQWEHSVY
FT                   LDAFCQDSYLAELLSWQLENKGVGYASDGMIRYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRRRGMRARLLNNGDDCVVIVEKECAAEVKSGMVRHWRQFGFQCELECDADIFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLISLSKDAYSVGPWNSINHARKWVNAVGLCGMSLTGGIPV
FT                   VQSYYNMFIRNTKTVNSSSILRDVSFASGFRELARLGNRSYRNISEESRFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIDWGFVPQGNPRIQPISWTLNAL"
FT   CDS             94. .900
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p29"
FT                   /product="29K protein"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1T4"
FT                   /protein_id="BAG13036.1"
FT                   /translation="METGLKFLVSGGLATSSVFRKVNAESLLDSSRASSDIIATVHGSM
FT                   INAVRDDCAKVAKVALCVGMAYAVWKAGSLWVRRRPVLRNAIVRGGEEVMEHITVGIDE
FT                   DEDSDAEDREEIIVGSIGIGVSRNVSPERKLKRRHRSKPFIRKIVHLTKNHFGGCPESS
FT                   KSNVMAVSKFVYDLCKQHNCLPHQTRMIISVAVPLVLSPDMYDISSRALLNSETLNENR
FT                   AKLDRLKTLDGWLSNLICHPLSAKAWRRTIDNLCGLPDWKAFRLIN"
FT   CDS             2448. .2645
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p7A"
FT                   /product="p7A protein"
FT                   /db_xref="GOA:B1B1T6"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1T6"
FT                   /protein_id="BAG13038.1"
FT                   /translation="MDSQRTVEQQNPRGRSRDRDDGGGKQKNSMGRKIANDAITESKQG
FT                   VMGASVYIADKIKVNISFNF"
FT   CDS             2649. .2834
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p7B"
FT                   /product="p7B protein"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1T7"
FT                   /protein_id="BAG13039.1"
FT                   /translation="MGCYRCDSGPGDYSGPLLILFLAFVFFYITSLGPHGNTYVHLSDN
FT                   SSVKTQYVGISTNGND"
FT   CDS             2821. .3993
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p42"
FT                   /product="capsid protein"
FT                   /db_xref="GOA:B1B1T8"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:B1B1T8"
FT                   /protein_id="BAG13040.1"
FT                   /translation="MAMIKRVNKLPTVQMAKQLLPLVPSAKLVNNAIDVVPLVVQGGKK
FT                   LSKAAKRLLGRYGGNITYTEGAKPGSVSAPVAISQRVAGMKPRFTQTAGSVKIVHRELI
FT                   TTILPADSLTVNNGDTNTGKYRVNPSNNALFTWLQGQAQLYDMYRFTKLRFTYIPTTNT
FT                   TATGRVSVIWDKDSQDPLPQDRAAISSYAHYADSAPWAENYLVVPCDNVWRYMNDTNAV
FT                   DRKLVDFGQLIFATYSSVSSVPHGDLYVEYTVEFKEPQPISGMTCMFDRDVSLGPVGST
FT                   IRGSNYISDTNVVTSGGNVGVFLNVPGTYLVTLVINAVTVGGLTFPGNGKLIGSSLNVT
FT                   GGGATSLSFTVASTGVPNASAATFNVGSVVTPTRVRLTISRSSPETAYLA"
XX
SQ   Sequence 4261 BP; 1089 A; 901 C; 1075 G; 1196 T; 0 other;

ab232926 Length: 4261  17-MAY-2011  Type: N  Check: 9495  ..

       1  cggaaatctc tagccgattc cccgtgctct gtgcccgtcc tggcaagtct
      51  ttcgagatat tggcgaggtt aaccgtaata acgtaggcta gcaatggaaa
     101  ctggattgaa atttctcgtc tctggaggtt tagccacctc ttctgttttt
     151  cgcaaggtaa atgcagagag tttattggat tcgtcccgtg cttcatctga
     201  cattatagcc actgtgcatg gatcaatgat taatgccgtt cgtgacgatt
     251  gtgctaaagt ggccaaggtt gctctgtgcg ttggtatggc ttacgcagtc
     301  tggaaagctg gatccctttg ggttcgtcgt cgaccagtcc tgcggaacgc
     351  catagtgcgc ggtggagaag aagtcatgga gcatatcact gttggtattg
     401  atgaagatga ggatagtgat gctgaagata gagaggaaat tattgttgga
     451  agcattggta tcggagtgag cagaaatgtc tcccctgagc gcaaattgaa
     501  acgtagacac cgatcaaagc ctttcattcg gaaaatcgtc cacttaacga
     551  aaaatcattt tggaggatgt cctgagtcta gcaaatcgaa tgtcatggca
     601  gtgagtaagt ttgtgtatga cttgtgtaag cagcataatt gccttccgca
     651  tcaaacgaga atgatcatca gcgttgcagt tccattggtg ttgagtcccg
     701  acatgtatga tatatctagt agagctctat tgaacagcga gactcttaac
     751  gagaatagag ctaaactgga tcgcctcaaa acgttggatg gatggctctc
     801  caatcttata tgccatccac tgagcgctaa ggcttggagg cggacaattg
     851  acaatctatg tggtcttcct gattggaagg cctttaggtt gatcaactag
     901  gggtgcctag aggagctcgc tgggttttgc acatctgtgc acagagggac
     951  acacccagac atgaccgagt atcctcagga acgtcccgtt aagacacgta
    1001  aactgttttg tttaggggga gtaggaacga gcgtgcagtt caatgtgcat
    1051  aacaactcaa tgagaaatct tagaagaggt ctcatggaac gcgtatttta
    1101  cgttgaaaat gagaagaaag agttggaacc tgcccctaaa ccccttgacg
    1151  gtgtgtttgg taacctagct tggtttcgtc ggaaacttca taatattgtt
    1201  ggtactcatt ccagtatatc gccgggtcaa ttcctggatt tttacactgg
    1251  caggaggcga accatatatg agggagccgt gaagtccttg gaagggctag
    1301  gggtccaacg tagagatgca tatcttaaga catttgttaa agctgaaaag
    1351  attaacacca caaggaaacc ggacccggct ccccgggtta tacaacctag
    1401  gaatgttcgt tacaacgttg aggttggtcg attcttgaga aggtttgagc
    1451  attatctcta taggggaatt gatgaaattt ggaatggtcc tactgtgatt
    1501  aaaggatata ctgttgagca aatcgggaaa atcgcccgcg atgcttggga
    1551  ttcattcgtg agtcccgtgg caatcgggtt tgacatgaag cgatttgacc
    1601  aacatgtatc catacctgct ctccaatggg aacacagcgt atatcttgat
    1651  gcgttctgtc aggacagtta tctcgcagag ttattgtctt ggcagctcga
    1701  gaataaggga gtgggctacg ctagtgatgg gatgataaga tataaggttg
    1751  atggttgtcg tatgagtggc gacatgaata ccgctatggg taattgtcta
    1801  atagcttgcg ctatcacgca tgactttttc cgtcgtcggg gtatgcgggc
    1851  tcgtctgctt aataatggtg atgactgcgt cgtgatcgtc gagaaggaat
    1901  gtgccgcaga ggttaaatct ggcatggtaa ggcactggcg acagttcggg
    1951  ttccaatgcg agcttgaatg cgatgctgac atcttcgagc aaattgaatt
    2001  ttgtcagatg agacccgtgt acgatgggga aaaatacgtc atggtgcgca
    2051  acccgctaat tagcttgtcc aaagatgcgt actctgtcgg cccttggaat
    2101  agcattaacc acgcacgcaa atgggtcaac gctgttggcc tgtgtggcat
    2151  gtccctgact ggtggtatac ctgttgtcca aagctattat aatatgttta
    2201  tccgtaatac caaaactgtc aatagttcca gcatccttcg tgatgtaagc
    2251  tttgccagtg ggtttaggga attagcaagg ttgggaaaca ggtcatatag
    2301  gaacatatct gaggagtcac gatttagctt ttatctcgca tttggcatta
    2351  ctcctgactt gcaacgtgcc atggaaagtg actatgatgc tcataccatc
    2401  gattggggct ttgtgcccca gggaaatccc agaatacaac caatctcatg
    2451  gactctcaac gcactgtaga acaacaaaat cctaggggca gaagtcgtga
    2501  tcgagatgac ggcgggggaa aacaaaagaa ttcaatgggg cgaaagatag
    2551  ccaatgacgc tatcacggaa tcgaagcagg gagtcatggg cgctagtgtc
    2601  tacatagcag ataaaattaa agtcaatatt agcttcaatt tctaagctat
    2651  gggatgctat cgttgtgact ctggccccgg ggattactct ggtccactgc
    2701  ttatactctt ccttgcattc gtcttctttt atattacctc gcttggcccg
    2751  cacggtaata catacgttca tctttccgat aactcttctg tcaagaccca
    2801  atacgttggc atctctacaa atggcaatga ttaaacgcgt caataagctt
    2851  cccactgtcc agatggcaaa gcagcttctt ccgctggtgc catctgctaa
    2901  actcgtgaat aacgctatag atgtggttcc actggttgtc caaggtggta
    2951  agaagttatc taaagccgcc aagcgcttgc ttggcaggta tggaggtaac
    3001  attacttaca ctgagggtgc gaaacctggg tccgtttccg ctcccgttgc
    3051  tattagtcag cgggttgccg gtatgaagcc caggtttacc caaacagctg
    3101  gatctgtgaa gatagtgcat agggaattga ttaccactat cttgcctgct
    3151  gatagtctca ctgttaacaa tggtgacact aacactggta agtatagagt
    3201  gaatccctct aataatgctt tattcacctg gttacaggga caagcccaac
    3251  tgtatgatat gtatagattc actaagttgc gatttacata cattccgact
    3301  accaacacga ctgcgacagg ccgcgtatct gtcatttggg ataaggattc
    3351  gcaagacccc ttgccccaag atagagccgc tattagcagt tatgctcact
    3401  acgctgactc agccccttgg gctgaaaatt atttggtggt cccatgcgat
    3451  aatgtttgga ggtatatgaa tgacactaat gctgtggatc gcaagttggt
    3501  tgattttggt caactgattt tcgctactta ctctagtgtc agttctgtcc
    3551  cccatggtga tctgtacgtt gaatacactg ttgaattcaa agaaccccaa
    3601  cccatttcag gcatgacgtg catgtttgac cgtgacgtgt ctcttggtcc
    3651  tgtcggatcg actattagag gatcaaatta cattagcgac accaacgttg
    3701  tcacctctgg tggtaacgta ggagtattcc tgaacgtccc gggcacttat
    3751  ttggttactc ttgttataaa tgccgtgact gttggtggtt taactttccc
    3801  tggcaatggc aaacttatcg gctcatctct caatgttaca ggtggtggcg
    3851  ccacttctct ttcatttacg gttgcaagta cgggtgttcc taacgcttca
    3901  gctgcaactt ttaatgttgg gtctgtggtc acgccgactc gagttcgttt
    3951  gactatatca aggtcatcac ctgaaactgc ctatttagct tagaatactt
    4001  ccacttttaa ggacccttcc tttagatcgt gttctctgga actgcatctg
    4051  cttttagttc ttgactcttc tcaaattgtg tagaatggac tggctaacca
    4101  ttacggcgta taagagagaa gggtgtgata gactaagggt gcacgaggcg
    4151  ccagaagatc gatctggagt ggggttaacg ccatctgcaa atacactctg
    4201  tgtggggcgg cagatggata gtcatgttac gattgaggag acttatcggg
    4251  tctccccgcc c