Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus genomic RNA, complete genome, strain: Chiba.

ACC No: AB250684

Dated: 2009-07-31 | Length: 4270 | CRC: 507759741

                ID   AB250684; SV 1; linear; genomic RNA; STD; VRL; 4270 BP.
XX
AC   AB250684;
XX
DT   17-FEB-2007 (Rel. 90, Created)
DT   31-JUL-2009 (Rel. 101, Last updated, Version 3)
XX
DE   Melon necrotic spot virus genomic RNA, complete genome, strain: Chiba.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4270
RA   Tsuda S.;
RT   ;
RL   Submitted (16-FEB-2006) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Shinya Tsuda National Agricultural Research Center, Dept. of Plant
RL   Pathology; Kan-non dai 3-1-1, Tsukuba, Ibaraki 305-8666, Japan
XX
RN   [2]
RA   Kido K., Tanaka C., Mochizuki T., Kubota K., Ohki T., Ohnishi J.,
RA   Knight L.M., Tsuda S.;
RT   "High Temperatures Activate Local Viral Multiplication and Cell-to-Cell
RT   Movement of Melon necrotic spot virus but Restrict Expression of Systemic
RT   Symptoms";
RL   Phytopathology 98:181-186(2008).
XX
RN   [3]
RA   Mochizuki T., Hirai K., Kanda A., Ohnishi J., Ohki T., Tsuda S.;
RT   "Induction of necrosis via mitochondrial targeting of Melon necrotic spot
RT   virus replication protein p29 by its second transmembrane domain";
RL   Virology 390:239-249(2009).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4270
FT                   /organism="Melon necrotic spot virus"
FT                   /strain="Chiba"
FT                   /mol_type="genomic RNA"
FT                   /country="Japan:Chiba"
FT                   /isolation_source="Melon"
FT                   /db_xref="taxon:11987"
FT   CDS             90. .2465
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /transl_except=(pos:894. .896,aa:OTHER)
FT                   /gene="p88"
FT                   /product="p88k-polymerase"
FT                   /note="readthrough product"
FT                   /db_xref="GOA:A2V6D2"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6D2"
FT                   /protein_id="BAF47084.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRTPGIVNSIITYGEEVVEQVKVDINE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVYLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLIERVFFVEND
FT                   KKELEPAPKPLSGVFDRLTWFRRKLHNIVGTHSSISPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRKDAYLKTFVKAEKINTTRKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSSDALKWEHSVY
FT                   LDAFCHDSYLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEVFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGINHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSVNSSGILRDVSFASGFRELARLGNRKSGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNPRIQPISWTLNEL"
FT   CDS             90. .896
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p28"
FT                   /product="p28k-polymerase"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6D3"
FT                   /protein_id="BAF47085.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRTPGIVNSIITYGEEVVEQVKVDINE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVYLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2444. .2641
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p7"
FT                   /product="p7k"
FT                   /db_xref="GOA:Q006Z8"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:Q006Z8"
FT                   /protein_id="BAF47086.1"
FT                   /translation="MDPQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2645. .2830
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p9"
FT                   /product="p9k"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UYH9"
FT                   /protein_id="BAF47087.1"
FT                   /translation="MACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             2817. .3989
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="CP 38k"
FT                   /db_xref="GOA:A2V6D6"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6D6"
FT                   /protein_id="BAF47088.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDTNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRVTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSSPWAENVLVVPCDNTWRYMNDTNAM
FT                   DRKLVDFGQFLFATYSGTGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGPLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 4270 BP; 1073 A; 877 C; 1065 G; 1255 T; 0 other;

ab250684 Length: 4270  31-JUL-2009  Type: N  Check: 4467  ..

       1  gggattactc tagccgaatc cccgactttc ttggtttctg tgagttagtt
      51  cgtatattgg ttgtctatct caatcaatac aggttagcaa tggatactgg
     101  tttgaaattt cttgtttccg gaggtttagc cacctcatct gttattagga
     151  aagtgagtgc tgtgagttca ttggattcgt cccttccttc atcgtctata
     201  ctatctgcca ttcatgggtc ttggactagt gctatcagcc acgattgtag
     251  caagattgcc aaggttgcca ccgtaattgg aattggttat cttggggttc
     301  ggattggtgc cgcatggtgt cgtcgtaccc ccgggatagt gaactctata
     351  attacatacg gggaagaagt ggttgagcaa gtaaaggtgg atattaatga
     401  agatgctgaa gaggagtccg atactggtga ggaaattgtg gttggcacga
     451  taggtattgg tatacacact aacgtcaacc ctgaagttcg agctaagcgt
     501  agacatagat cgaggccatt cattaagaaa attgtgtatt taacgaaaaa
     551  tcactttggt ggatgtcccg attcaagtaa atcgaacgtc atggctgtta
     601  gcaaatttgt ttatgaacaa tgtaaacagc acaattgtct tccacatcag
     651  acgagattga tcatgagtgt tgcagttcca ttggtgttaa gtcccgacat
     701  gtacgacatt tccagtaaag ctctgttaaa cagcgagata ttaacagaaa
     751  acagagccac actggaccgc ctcaaaactc ttgatgggtg gctgtcacat
     801  ttagtgtgcc acccccttag cgcgaaggct tggaggcggg cgattgacaa
     851  cttgtgtggt cttcctgact ggaaggcctt caagttggtc aactaggggt
     901  gcctagagga actcgctggg ttctgtactt cggtacggag agggacgcac
     951  ccagacatga ccgagtttcc tcaggatcgt cccattaaga cacgcaaact
    1001  gtattgtttg gggggagttg gaaccagcgt gaagttcaat gtgcacaata
    1051  actctctagc taaccttcgg cgcggtctca tagaacgtgt tttctttgtg
    1101  gaaaatgata agaaggaact agagcctgcc cctaaacccc ttagtggtgt
    1151  gtttgatcgc ttaacctggt ttcgtcggaa actccataat attgtgggta
    1201  ctcattccag tattagtcca ggtcaattct tggatttcta tactggcagg
    1251  aggcgtacaa tttatgaagg tgccgtgaag tcattggagg ggttaagtgt
    1301  tcaaagaaag gatgcctatt tgaaaacgtt tgttaaggcg gagaagatta
    1351  acaccactag gaagcctgac ccagctccgc gggtcataca accgaggaac
    1401  gtaagatata atgttgaggt tggtcgttat ctacgtaggt ttgagcatta
    1451  cctctatcga ggaattgatg aaatctggaa tggccccacg ataattaaag
    1501  gatacactgt cgagcaaatt gggaaaatcg ctcgtgatgc ttgggactct
    1551  ttcgtgagcc ccgtggcaat cgggtttgat atgaagaggt tcgaccaaca
    1601  tgtatcctcc gacgctctta aatgggaaca tagtgtttat cttgatgctt
    1651  tttgccatga ttcttatctt gcagaattgt tggagtggca attagtcaat
    1701  aagggagtcg ggtatgccag tgatggaatg atcaaatata aggttgatgg
    1751  gtgccgaatg agtggtgata tgaatacagc tatgggtaac tgtttgattg
    1801  cctgtgccat cacacatgat ttcttccgta gtcgtggcat cagggcgcgt
    1851  ttgatgaaca atggtgatga ctgtgtcgta atatgcgaaa aagaatgtgc
    1901  cgcggtggtt aaagccgaca tggtaaggca ctggagacaa ttcgggtttc
    1951  aatgtgagct cgaatgcgac gcagaagtct tcgagcaaat tgagttttgt
    2001  caaatgcggc ctgtgtacga cggggaaaaa tatgtgatgg tgcggaatcc
    2051  gttagttagt ctgtctaaag attcatactc agtcggccca tggaatggaa
    2101  tcaaccatgc acgcaagtgg gttaatgctg ttggcttgtg tggcttatcc
    2151  ctcactggtg gaattcctgt tgtccaaagt tactataata tgatgattcg
    2201  taacactcag tccgtgaaca gttctggcat tcttcgggat gtcagttttg
    2251  ctagtggatt tcgggagtta gcgcgattgg gtaacaggaa aagtggtgct
    2301  atatcagaag acgcccgttt tagcttttat ctcgcatttg gcattactcc
    2351  agatttacaa cgtgccatgg aaagtgacta tgatgctcat accatagagt
    2401  ggggtttcgt gccccaggga aatcctagaa tacagccaat ctcatggacc
    2451  ctcaacgaac tgtagaacaa actaatcctc ggggaagaag taaagaacgt
    2501  ggtgacagcg ggggaaaaca gaagaactca atggggcgaa agatagccaa
    2551  tgatgctatc tctgaatcga agcagggagt tatgggtgct agcacataca
    2601  tcgctgataa aattaaggta actatcaact ttaattttta gtgtatggct
    2651  tgttaccgtt gtgactccag ccccggggat tactctggag ctctgcttat
    2701  attatttatc tcatttgttt tcttctatat tacctcgctt agcccgcaag
    2751  gaaatactta cgttcaccac ttcgataatt cttccgttaa gacgcaatac
    2801  gttggcatct ctacaaatgg cgatggttaa acgcattaat aatttaccaa
    2851  cagtgaagct tgctaagcag gccctgcccc tgctaacgaa tcctaaaatt
    2901  gtgaataagg ccatagatgt ggttcctttg gtcgtccagg gtggtcagaa
    2951  attgtccaaa gctgccaagc ggttgcttgg cgcttatggt ggtaacattt
    3001  cttacactga gggcgctaag cctggtgcta tatccgctcc agttgccatt
    3051  agtaggcgag tggcggggat gaagcctagg tttgttcgat ccgaaggatc
    3101  tgtgaagata gttcataggg agtttattgc ctctgttctt ccgtcgaatg
    3151  atctcaccgt gaacaatggt gataccaata tcggtaagta tagggtcaat
    3201  cccagtaata acgctttatt cacatggctt cagggacaag cgcaattata
    3251  tgatatgtac agatttactc gacttcgagt tacctatatt ccaactaccg
    3301  gatccacttc cacaggtcgt gtttctatcc tttgggatag agactctcag
    3351  gatcccctcc ctattgatcg cgccgctatt agttcttatg ctcattacgc
    3401  agactcatcg ccttgggcag agaacgtttt agtggttccg tgtgacaata
    3451  cgtggaggta tatgaatgat actaatgcaa tggatcggaa gttggttgat
    3501  tttgggcagt ttctctttgc tacttattct ggtactggtg ccaccgccca
    3551  tggtgatctc tacgttgagt acgctgttga attcaaagat ccccagccga
    3601  ttgctggaat ggtgtgtatg tttgatcgct tggtctcttt ctctgaagtc
    3651  ggatctacaa ttaaaggagt caattatatt gctgatcgtg acgtgataac
    3701  tacggggggt aatattggtg tcaacatcaa tattcccggg acttatctcg
    3751  tcacgattgt tcttaatgcc acatcaattg gccccctcac cttcactggt
    3801  aattctaaac tcgtaggcaa tagtcttaac gttaccagca gtggtgcttc
    3851  tgctctcaca tttaccctta actccactgg tgtgcccaac agttccaatt
    3901  cttcattctc tgtgggcact gttgttgcat tgactagggt ccgtatgacg
    3951  atcactcgct gctctcctga aactgcctac ctcgcctaaa atttaattta
    4001  ctatactcca aatctggtct ctctcatacc ttcctgttct cagccagatc
    4051  tctgttctgg tgtcctatag gtgtccttgt cgtgtgtagt gcggtctggc
    4101  taaccgtaac ggcgtatcgg cttggttctc cgacgattag gctccgggat
    4151  gtacgacata gttgaagatg gatggtgttt ggtagatcac cgctagcaaa
    4201  atacactctg tgtggggcgt gctagtggat agtcatgtat gtttgagatg
    4251  ggttataggc ccatcccgcc