Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus genomic RNA, complete genome, strain: Kochi.

ACC No: AB250685

Dated: 2009-07-31 | Length: 4271 | CRC: 1486996435

                
ID   AB250685; SV 1; linear; genomic RNA; STD; VRL; 4271 BP.
XX
AC   AB250685;
XX
DT   17-FEB-2007 (Rel. 90, Created)
DT   31-JUL-2009 (Rel. 101, Last updated, Version 3)
XX
DE   Melon necrotic spot virus genomic RNA, complete genome, strain: Kochi.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4271
RA   Tsuda S.;
RT   ;
RL   Submitted (16-FEB-2006) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Shinya Tsuda National Agricultural Research Center, Dept. of Plant
RL   Pathology; Kan-non dai 3-1-1, Tsukuba, Ibaraki 305-8666, Japan
XX
RN   [2]
RA   Kido K., Tanaka C., Mochizuki T., Kubota K., Ohki T., Ohnishi J.,
RA   Knight L.M., Tsuda S.;
RT   "High Temperatures Activate Local Viral Multiplication and Cell-to-Cell
RT   Movement of Melon necrotic spot virus but Restrict Expression of Systemic
RT   Symptoms";
RL   Phytopathology 98:181-186(2008).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4271
FT                   /organism="Melon necrotic spot virus"
FT                   /strain="Kochi"
FT                   /mol_type="genomic RNA"
FT                   /country="Japan:Kochi"
FT                   /isolation_source="Melon"
FT                   /db_xref="taxon:11987"
FT   CDS             90. .2465
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /transl_except=(pos:894. .896,aa:OTHER)
FT                   /gene="p88"
FT                   /product="p88k-polymerase"
FT                   /note="readthrough product"
FT                   /db_xref="GOA:A2V6D7"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6D7"
FT                   /protein_id="BAF47089.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRTPGIANSIITYGEEVVEQVKVDIDE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLIERVFFVEND
FT                   KKELEPAPKPLSGVFDRLTWFRRKLHNIVGTHSSISPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRRDAYLKTFVKAEKINTTRKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSSDALKWEHSVY
FT                   LDAFCHDSYLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEVFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGINHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSVNSSGILRDVSFASGFRELARLGNRKSGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNPRIQPISWTLNEL"
FT   CDS             90. .896
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p28"
FT                   /product="p28k-polymerase"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6D8"
FT                   /protein_id="BAF47090.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRTPGIANSIITYGEEVVEQVKVDIDE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2444. .2641
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p7"
FT                   /product="p7k"
FT                   /db_xref="GOA:A2V6D9"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6D9"
FT                   /protein_id="BAF47091.1"
FT                   /translation="MDSQRAVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2645. .2830
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p9"
FT                   /product="p9k"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UYH9"
FT                   /protein_id="BAF47092.1"
FT                   /translation="MACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             2817. .3989
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="CP 38k"
FT                   /db_xref="GOA:A2V6E1"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6E1"
FT                   /protein_id="BAF47093.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDANIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAEDVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRSVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGVSALTFTLNSTGVPNSTNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 4271 BP; 1064 A; 889 C; 1077 G; 1241 T; 0 other;

ab250685 Length: 4271  31-JUL-2009  Type: N  Check: 5363  ..

       1  gggattactc tagccggatc cccgactttc ttggtttttg tgagttagtt
      51  cgtatattgg ttatctatct tagtcaatac aggttagcaa tggatactgg
     101  tttgaaattt cttgtttccg gaggtttagc cacctcatct gttattagga
     151  aagtgagtgc tgtgagttcc ttggattcgt cccttccttc atcgtctata
     201  ctatctgcca ttcatgggtc ttggactagt gctatcagcc acgattgtag
     251  caagattgcc aaggttgcca ccgtgattgg aattggttat ctcggggttc
     301  ggattggtgc cgcatggtgt cgtcgtaccc ccgggatagc gaattctata
     351  attacatatg gggaagaagt ggttgagcaa gtaaaggtgg atattgatga
     401  agatgctgaa gaggagtccg atactggtga ggaaattgtg gttggcacga
     451  taggtattgg tatacacaca aatgtcaacc ctgaagttcg agctaagcgc
     501  agacatagat cgaggccatt tattaagaag attgtgaatt taacgaaaaa
     551  tcactttggt ggatgccccg attcaagcaa atcgaacgtc atggctgtta
     601  gcaaatttgt ttatgaacaa tgtaaacagc ataattgtct tccacatcag
     651  acgagattga tcatgagtgt tgcagttcca ttggtgttaa gtcccgacat
     701  gtacgacatt tctagtaaag ctctgttgaa cagcgagata ttaacagaaa
     751  acagagctac actggaccgc ctcaaaactc ttgacgggtg gctgtcacat
     801  ttggtgtgcc acccccttag cgcgaaggct tggaggcggg cgattgataa
     851  cttgtgtggc cttcctgatt ggaaggcctt caagttggtc aactaggggt
     901  gcctagagga actcgctggg ttctgtactt cggtacggag ggggacgcac
     951  ccagacatga ccgagtttcc tcaggatcgt cccattaaga cacgcaaact
    1001  gtattgtttg gggggagttg gaactagcgt gaagttcaat gtacacaata
    1051  actctctagc taaccttcgg cgcggtctta tagaacgcgt tttctttgtt
    1101  gaaaatgata agaaggaact agagcctgcc cctaaacccc ttagtggtgt
    1151  gtttgaccgc ttaacctggt ttcgtcggaa actccataac attgtgggta
    1201  ctcattccag tattagtccg ggtcaattct tggatttcta tactggcagg
    1251  aggcgtacaa tttatgaagg tgccgtgaag tcattggagg ggttaagtgt
    1301  tcaaagaagg gatgcctatt tgaaaacgtt tgttaaggcg gagaagatta
    1351  acaccactag gaagcctgac ccagctccgc gggtcataca accgaggaac
    1401  gtaagatata atgttgaggt tggtcgttat ctacgtaggt ttgagcatta
    1451  cctctatcga ggaattgatg aaatctggaa tggccccaca ataattaaag
    1501  gatacactgt cgagcaaatt gggaaaatcg ctcgtgatgc ttgggactct
    1551  ttcgtaagcc ccgtggcaat cgggtttgat atgaagaggt tcgaccaaca
    1601  tgtatcctcc gacgctctta aatgggaaca tagtgtgtat cttgatgctt
    1651  tttgccatga ttcttatctt gcagaattgt tggagtggca attagtcaat
    1701  aagggggtcg gatatgccag tgatggaatg atcaaatata aggttgatgg
    1751  gtgccggatg agtggtgaca tgaatacagc tatgggcaac tgtctgattg
    1801  cctgcgctat cacacatgat ttcttccgaa gtcgtggcat cagggcgcgt
    1851  ttgatgaaca atggtgatga ctgtgtcgta atatgtgaaa aagaatgtgc
    1901  cgcggtggtt aaagccgaca tggtaaggca ctggagacaa ttcgggtttc
    1951  aatgtgagct cgaatgcgac gcagaagtct tcgagcaaat tgagttttgt
    2001  caaatgcggc ctgtgtacga cggggaaaag tatgtgatgg tgcggaatcc
    2051  gttggttagc ctgtctaaag attcatactc agtcggccca tggaacggaa
    2101  tcaaccatgc acgcaagtgg gttaacgctg taggcttgtg tggcttatcc
    2151  ctcactggtg gaattcctgt tgtccaaagt tactataaca tgatgattcg
    2201  taacactcaa tccgtgaaca gttctggcat tcttcgagat gttagttttg
    2251  ctagtggatt tcgggagtta gcgcgattgg gtaacaggaa aagtggtgcc
    2301  atatcagaag acgcccgttt tagcttttat ctcgcatttg gcattactcc
    2351  agatttacaa cgtgccatgg aaagtgacta tgatgctcat accatagagt
    2401  ggggtttcgt gccccaggga aatcctagaa tacagccaat ctcatggact
    2451  ctcaacgagc tgtagaacaa actaatcctc ggggaaggag taaagaacgt
    2501  ggtgacagcg ggggaaaaca gaagaactca atggggcgaa agatagccaa
    2551  tgatgctatc tctgaatcga agcagggagt tatgggtgct agcacataca
    2601  tcgctgataa aatcaaggtg actataaact ttaattttta gtgtatggct
    2651  tgttatcgtt gtgactccag ccccggggat tactctggag ctctgcttat
    2701  attatttatc tcatttgttt tcttctatat tacctcgctt agcccgcaag
    2751  gaaatactta cgttcaccac ttcgataatt cttccgttaa aacgcaatac
    2801  gttggcatct ctacaaatgg cgatggttaa acgcattaat aatttaccga
    2851  cagtgaagct tgctaagcag gccctgcccc tgctaacgaa tcctaaaatt
    2901  gtgaataagg ctatagatgt ggttcctttg gtcgtccaag gtggtcagaa
    2951  attgtccaaa gctgccaagc ggttgcttgg tgcttatggt ggtaacattt
    3001  cttatactga gggcgctaag cctggtgcta tatccgcccc agttgccatt
    3051  agtaggcgag tggcgggtat gaagcctagg tttgttcgat ccgaaggatc
    3101  tgtgaagata gttcataggg agtttattgc ctctgttctt ccgtcgaatg
    3151  atctcaccgt gaataacggt gatgccaata tcggtaagta tagggtcaat
    3201  cccagtaata acgctttatt cacatggctt cagggacaag cgcaattgta
    3251  tgatatgtac agatttactc ggcttcgatt tacctatatt ccaaccaccg
    3301  gatccacttc cacaggtcgt gtctctattc tctgggatag agactctcag
    3351  gatcccctcc ctattgaccg cgccgccatt agttcttatg cgcattacgc
    3401  tgattcagcg ccttgggcag aggacgtttt agtggttccg tgtgacaaca
    3451  cgtggaggta tatgaatgac accaatgctg tggaccggaa gttggttgat
    3501  tttgggcagt tcctctttgc tacttattct ggtgctggtg ccaccgccca
    3551  cggtgatctc tacgttgagt acgctgttga attcaaagat ccccagccta
    3601  ttgctggaat ggtctgtatg tttgatcgct cggtctcttt ctctgaagtc
    3651  ggatctacaa ttaaaggagt caattacatt gctgaccgtg atgtgataac
    3701  cactggaggc aatattggtg ttaatatcaa tattccaggg acttatctcg
    3751  tcacgattgt acttaacgcc acttcaattg gctcccttac cttcactggc
    3801  aattctaaac tcgtaggcaa tagtcttaac gttactagca gcggcgtttc
    3851  agctcttaca ttcaccctta attccactgg tgtgcccaac agtaccaatt
    3901  cttctttctc tgtgggcact gtcgttgcat tgactagggt tcgtatgacg
    3951  attactcgct gctctcctga aactgcctac ctcgcctaaa attacattta
    4001  ctatactccg aaatctggtc tcccttatac ctacctgttc tcagccagat
    4051  ctctgttctg gtgtcctata ggtgtccttg tcgtgtgtag tgcggtctgg
    4101  ctaaccgtaa cggcgtatcg gctcggttct ccgacgatta ggctctggga
    4151  tgtacgacat agctgaagat ggatggtgtt cggtagatca ccgctagcaa
    4201  aatacactct gtgtggggcg tgctagtgga tagtcatgta tgtttgagat
    4251  gggttatagg cccatcccgc c