Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus genomic RNA, complete genome, strain: Nagasaki.

ACC No: AB250686

Dated: 2009-07-31 | Length: 4271 | CRC: -1871109529

                
ID   AB250686; SV 1; linear; genomic RNA; STD; VRL; 4271 BP.
XX
AC   AB250686;
XX
DT   17-FEB-2007 (Rel. 90, Created)
DT   31-JUL-2009 (Rel. 101, Last updated, Version 3)
XX
DE   Melon necrotic spot virus genomic RNA, complete genome, strain: Nagasaki.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4271
RA   Tsuda S.;
RT   ;
RL   Submitted (16-FEB-2006) to the EMBL/GenBank/DDBJ databases.
RL   Contact:Shinya Tsuda National Agricultural Research Center, Dept. of Plant
RL   Pathology; Kan-non dai 3-1-1, Tsukuba, Ibaraki 305-8666, Japan
XX
RN   [2]
RA   Kido K., Tanaka C., Mochizuki T., Kubota K., Ohki T., Ohnishi J.,
RA   Knight L.M., Tsuda S.;
RT   "High Temperatures Activate Local Viral Multiplication and Cell-to-Cell
RT   Movement of Melon necrotic spot virus but Restrict Expression of Systemic
RT   Symptoms";
RL   Phytopathology 98:181-186(2008).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4271
FT                   /organism="Melon necrotic spot virus"
FT                   /strain="Nagasaki"
FT                   /mol_type="genomic RNA"
FT                   /country="Japan:Nagasaki"
FT                   /isolation_source="Melon"
FT                   /db_xref="taxon:11987"
FT   CDS             90. .2465
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /transl_except=(pos:894. .896,aa:OTHER)
FT                   /gene="p88"
FT                   /product="p88k-polymerase"
FT                   /note="readthrough product"
FT                   /db_xref="GOA:A2V6E2"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6E2"
FT                   /protein_id="BAF47094.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRAPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLIERVFFVEND
FT                   KKELEPAPKPLSGVFDRLTWFRRKLHNIVGTHSSISPGKFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRKDAYLKTFVKAEKINTTKKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSSDALKWEHSVY
FT                   LDAFCHDSYLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEVFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGVNHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSVNSSGILRDVSFASGFRELARLGNRKSGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNPRIQPISWTLNEL"
FT   CDS             90. .896
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p28"
FT                   /product="p28k-polymerase"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6E3"
FT                   /protein_id="BAF47095.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVATVIGIGYLGVRIGAAWCRRAPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDTGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2444. .2641
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p7"
FT                   /product="p7k"
FT                   /db_xref="GOA:Q8V993"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8V993"
FT                   /protein_id="BAF47096.1"
FT                   /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2645. .2830
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="p9"
FT                   /product="p9k"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProtKB/TrEMBL:Q8UYH9"
FT                   /protein_id="BAF47097.1"
FT                   /translation="MACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             2817. .3989
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="CP 38k"
FT                   /db_xref="GOA:A2V6E6"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:A2V6E6"
FT                   /protein_id="BAF47098.1"
FT                   /translation="MAMVKRINNLPTVKLTKQALPLLTNPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGARPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNIGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSTPWAENVLVVPCDNTWRYMNDTSAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRLVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   SSGASALTFTLNSTGVPNSTNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 4271 BP; 1080 A; 886 C; 1063 G; 1242 T; 0 other;

ab250686 Length: 4271  31-JUL-2009  Type: N  Check: 4442  ..

       1  gggattactc tagccgaatc cccgactttc ttggtttttg tgagttagtt
      51  cgtatattgg ttatctctct taatcaatac aggttagcaa tggatactgg
     101  tttgaaattt cttgtttctg gaggtttagc cacctcatct gttattagga
     151  aagtgagtgc tgtgagttca ttggattcgt cccttccttc atcgtctata
     201  ctatctgcca ttcatgggtc ttggactagt gctatcagcc acgattgtag
     251  caagattgcc aaggttgcca ccgtgattgg aattggttat cttggggttc
     301  gaattggtgc cgcatggtgt cgtcgtgccc ccggaataac gaattctata
     351  attacatacg gggaagaagt ggttgagcaa gtaaaggtgg atattgatga
     401  agatgctgaa gaggagtccg atactggtga ggaaattgtg gttggcacga
     451  taggtattgg tatacacact aacgtcaacc ctgaggttcg agctaagcgc
     501  agacatagat cgaggccatt cattaagaag attgtgaatt taacgaaaaa
     551  tcactttggt ggatgccccg attcaagtaa atcgaacgtc atggctgtta
     601  gcaagtttgt ttatgaacaa tgtaaacagc acaattgtct tccacatcag
     651  acgagattga tcatgagtgt tgcagttcca ttggtgttaa gtcccgacat
     701  gtacgatatt tccagtaaag ctctgttaaa cagcgagata ttgacagaaa
     751  acagagctac actggaccgc ctcaaaactc ttgacgggtg gctgtcacat
     801  ttagtgtgcc acccccttag cgcgaaggct tggaggcggg cgattgacaa
     851  cttatgtggt cttcctgact ggaaggcctt caagttggtc aactaggggt
     901  gcctagagga actcgctggg ttctgtactt cggtacggag ggggacgcac
     951  ccagacatga ccgagtttcc tcaggatcgt cccattaaga cacgcaaact
    1001  gtattgtttg gggggagttg gaactagcgt gaagttcaat gtacacaaca
    1051  actctctagc taaccttcgg cgcggtctta tagaacgcgt tttctttgtt
    1101  gaaaatgata agaaggaact agagcctgcc cctaaacccc ttagtggtgt
    1151  gtttgaccgc ttaacctggt ttcgtcggaa actccataac attgtgggta
    1201  ctcattccag tattagtcca ggtaaattct tggatttcta tactggcagg
    1251  aggcgtacaa tctatgaggg tgccgtgaag tcattggagg ggttaagtgt
    1301  tcaaagaaag gatgcctatt tgaaaacgtt tgttaaggcg gagaagatta
    1351  acaccactaa gaagcctgac ccagctccgc gggtcataca accgaggaac
    1401  gtaagatata atgttgaggt tggtcgttat ctacgtaggt ttgagcatta
    1451  cctctatcga ggaattgatg aaatctggaa tggccccact ataattaaag
    1501  gatacactgt cgagcaaatt gggaaaatcg ctcgtgatgc ttgggactct
    1551  ttcgtgagcc ccgtggcaat cgggtttgat atgaagaggt tcgaccaaca
    1601  tgtatcctcc gacgctctta aatgggaaca cagtgtttat cttgatgctt
    1651  tttgccatga ttcttatctt gcagaattgt tggagtggca attagtcaat
    1701  aaaggagtcg ggtatgccag tgacggaatg atcaaatata aggttgatgg
    1751  gtgccggatg agtggtgaca tgaatacagc tatgggcaac tgtctgattg
    1801  cctgtgctat cacacatgat ttcttccgta gtcgtggtat cagggcgcgt
    1851  ttgatgaaca atggtgatga ctgtgtcgta atatgtgaaa aagaatgtgc
    1901  cgcggtggtt aaagccgaca tggtaaggca ctggagacaa ttcgggtttc
    1951  aatgcgagct cgaatgcgac gcagaagtct tcgagcaaat tgagttttgt
    2001  caaatgcgac ctgtgtacga cggggaaaaa tatgtgatgg tgcggaatcc
    2051  gctagttagc ctgtctaaag attcatactc agtcggccca tggaatggag
    2101  tcaaccatgc acgcaagtgg gtaaatgccg taggcttgtg tggcttatcc
    2151  ctcactggtg gaattcctgt tgtccagagt tactataata tgatgattcg
    2201  taatactcaa tccgtgaaca gttctggcat tctccgggat gtcagttttg
    2251  ctagtggatt tcgggagtta gcgcgattgg gtaacaggaa aagtggtgcc
    2301  atatcagaag acgcccgttt tagcttttat ctcgcatttg gcattactcc
    2351  agatttacaa cgtgccatgg aaagtgacta tgatgctcat accatagagt
    2401  ggggtttcgt gccccaggga aatcctagaa tacagccaat ctcatggact
    2451  ctcaacgaac tgtagaacaa actaatcctc ggggaagaag taaagaacgt
    2501  ggtgacagcg ggggaaaaca gaagaactca atggggcgaa agatagccaa
    2551  tgatgctatc tctgaatcga agcagggagt tatgggtgct agcacatata
    2601  ttgctgataa aattaaggtg actatcaact ttaattttta gtgtatggct
    2651  tgttaccgtt gtgactccag ccccggggat tactctggag ctttgcttat
    2701  attatttatc tcatttgttt tcttctatat tacctcgctt agcccgcaag
    2751  gaaatactta cgttcaccac ttcgataatt cttccgttaa aacgcaatac
    2801  gttggcatct ctacaaatgg cgatggttaa acgcattaat aatttaccaa
    2851  cagtgaagct tactaagcag gccctgcccc tgttaacgaa tcctaaaatt
    2901  gtgaataagg ctatagatgt ggttcctttg gtcgtccaag gtggtcagaa
    2951  attgtccaaa gctgccaagc ggctgcttgg cgcttatggt ggtaacattt
    3001  cttacactga gggtgctaga cctggtgcaa tatccgctcc agttgccatt
    3051  agtaggcgag tggcgggtat gaagcctagg tttgttcgat ccgaaggatc
    3101  agtgaagata gttcataggg agtttattgc ctctgttctt ccgtcaaatg
    3151  atctcaccgt gaataatggt gatgtcaata tcggtaagta tagggtcaat
    3201  cccagtaata acgctttatt cacatggctt cagggacaag cgcaattata
    3251  tgatatgtac agatttactc gactacgatt tacctatatt ccaaccaccg
    3301  gatccacttc tacaggtcgt gtttctattc tttgggatag agactctcag
    3351  gatcccctcc ctattgaccg cgccgctatt agttcttatg ctcattacgc
    3401  tgattcaacg ccttgggcag agaacgtttt agtggttccg tgtgacaata
    3451  cgtggaggta catgaatgat accagcgcag tggaccggaa gttggttgat
    3501  tttgggcagt tcctctttgc tacctattct ggtgctggtg ccaccgccca
    3551  cggtgatctc tacgttgagt atgctgtgga attcaaagat ccccagccta
    3601  ttgctggaat ggtttgtatg tttgatcgct tggtctcttt ctctgaagtc
    3651  ggatccacaa ttaaaggagt caattatatt gctgatcgtg atgtgataac
    3701  cactgggggc aatattggtg tcaacatcaa tattcccggg acttacctcg
    3751  ttacgattgt tcttaacgct acatcaattg gctccctcac cttcactggt
    3801  aattctaaac tcgtaggcaa tagtcttaac gttaccagca gtggcgcttc
    3851  agctcttaca ttcaccctta attccactgg tgtgcccaac agtactaatt
    3901  cttcattctc tgtgggcacc gttgttgcat tgaccagggt tcgtatgacg
    3951  attactcgct gctctcctga aactgcctac ctcgcctaag aattaattta
    4001  ctatactcca aaatctggtc tcccctatac ctacctgttc tcagccagat
    4051  ctctgttctg gtgtcctata ggtgtccttg tcgtgtgtag tgcggtctgg
    4101  ctaaccgtaa cggcgtatcg gctcggttct ccgatgatta ggctccggga
    4151  tgcacgacat agctgaagat ggatggtgtt cggtagatca ccgctagcaa
    4201  aatacactct gtgtggggcg tgctagtgga tagtcatgta tgtttgagat
    4251  gggttatagg cccatcccgc c