Sequence of DPV Carnation mottle virus

Carnation mottle virus, complete genome.

ACC No: AF192772

Dated: 2005-04-15 | Length: 4003 | CRC: 1993886897

                !!NA_SEQUENCE 1.0
ID   AF192772   standard; genomic RNA; VRL; 4003 BP.
XX
AC   AF192772;
XX
SV   AF192772.1
XX
DT   14-DEC-1999 (Rel. 62, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Carnation mottle virus, complete genome.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4003
RA   Zhang A.P., Yue Y., Ye R., Zhu H.Q., Xu L., Yu S.Q.;
RT   "Infectivity of full-length cDNA of carnation mottle virus";
RL   Chin. Sci. Bull. 0:0-0(1999).
XX
RN   [2]
RP   1-4003
RA   Zhang A.P., Yue Y., Ye R., Zhu H.Q., Xu L., Yu S.Q.;
RT   ;
RL   Submitted (07-OCT-1999) to the EMBL/GenBank/DDBJ databases.
RL   Microbiology, Fudan University, 220 Handan Road, Shanghai 200433, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4003
FT                   /country="China:Shanghai"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT                   /strain="shanghai"
FT                   /specific_host="Dinnthus caryophyllus"
FT   CDS             70. .2361
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9J5U7"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9J5U7"
FT                   /note="reads through stop codon"
FT                   /transl_except=(pos:805. .807,aa:OTHER)
FT                   /product="polymerase-associated protein"
FT                   /protein_id="AAF15525.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GARRIVSSGGRCLIVQSPYGNPNQGLIRGEDEEIDNVEESTPEELTQLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFVRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYARKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEMWCVVNGFDSNKPVTFPKXGGLFYLNGVETKIRRGGHPSVIEVDGQCPPRERKL
FT                   YVQNAITTGYEYRVHNHSYANLRRGLLERVFYVERNKELVSCPQPEPGSFKEMGYLRRR
FT                   FHRVCGNHTRISANDLVDCYQGRKRTIYENAAASLLDRAIERKDGDLKTFIKAEKFNVN
FT                   LKSDPAPRVIQPRSPRYNVELGRYLKKYEHHAYKALDKIWGGPTVMKGYTTEEVAQHIW
FT                   SAWNQFQTPVAIGFDMSRFDQHVSVAALEFEHSCYLACFEGDAHLANLLKMQLVNHGVG
FT                   FASNGMLRYTKEGCRMIGDMNTALGNCLLACLITKHLMKIRSRLINNGDDCVLICERTD
FT                   IDYVVSNLTTGWSRFGFNCIAEEPVYEMEKIRFCQMAPVFDGAGWLMVRDPLVSMSKDS
FT                   HSLVHWNNETNAKQWLKSVGMCGLRIAGGVPIVQEFYQKYVETAGNVKENKNITEKSSS
FT                   GFFMMADRAKRGYSAVSEMCRFSFYQAFGITPDQQIALEGEIRSLTIDTNVGPQCEAAD
FT                   SLWILNRKYQ"
FT   CDS             70. .807
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q9Q6X8"
FT                   /product="polymerase-associated protein"
FT                   /protein_id="AAF15524.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GARRIVSSGGRCLIVQSPYGNPNQGLIRGEDEEIDNVEESTPEELTQLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFVRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYARKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEMWCVVNGFDSNKPVTFPK"
FT   CDS             70. .2679
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9J5U6"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9J5U6"
FT                   /note="reads through stop codon"
FT                   /transl_except=(pos:805. .807,aa:OTHER)
FT                   /transl_except=(pos:2359. .2361,aa:OTHER)
FT                   /product="polymerase-associated protein"
FT                   /protein_id="AAF15527.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GARRIVSSGGRCLIVQSPYGNPNQGLIRGEDEEIDNVEESTPEELTQLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFVRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYARKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEMWCVVNGFDSNKPVTFPKXGGLFYLNGVETKIRRGGHPSVIEVDGQCPPRERKL
FT                   YVQNAITTGYEYRVHNHSYANLRRGLLERVFYVERNKELVSCPQPEPGSFKEMGYLRRR
FT                   FHRVCGNHTRISANDLVDCYQGRKRTIYENAAASLLDRAIERKDGDLKTFIKAEKFNVN
FT                   LKSDPAPRVIQPRSPRYNVELGRYLKKYEHHAYKALDKIWGGPTVMKGYTTEEVAQHIW
FT                   SAWNQFQTPVAIGFDMSRFDQHVSVAALEFEHSCYLACFEGDAHLANLLKMQLVNHGVG
FT                   FASNGMLRYTKEGCRMIGDMNTALGNCLLACLITKHLMKIRSRLINNGDDCVLICERTD
FT                   IDYVVSNLTTGWSRFGFNCIAEEPVYEMEKIRFCQMAPVFDGAGWLMVRDPLVSMSKDS
FT                   HSLVHWNNETNAKQWLKSVGMCGLRIAGGVPIVQEFYQKYVETAGNVKENKNITEKSSS
FT                   GFFMMADRAKRGYSAVSEMCRFSFYQAFGITPDQQIALEGEIRSLTIDTNVGPQCEAAD
FT                   SLWILNRKYQXLRSKCSLGIEENKRHVDRWPRMPSANLHPIVLTGVIGLMLLIRLRCTF
FT                   TSTFSLPPLVTLNQIIALSFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   CDS             2669. .3715
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9Q6X7"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9Q6X7"
FT                   /note="coat protein"
FT                   /gene="cp"
FT                   /product="p38"
FT                   /protein_id="AAF15526.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNSPPRTSRNSPGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRLVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQMLKITKTSAEQP
FT                   LKVVVYRM"
XX
SQ   Sequence 4003 BP; 1134 A; 862 C; 1091 G; 916 T; 0 other;

 AF192772  Length: 4003  April 19, 2005 08:54  Type: N  Check: 7388  ..

       1  gggtaagctg gcgggcaaac ctacactcta tcttacttac attatatatc
      51  ctaaccatct gctttcacta tgggattacc cagtctacta gtggaaggcg
     101  ttattgggtg cactctagtt ggtggtttag tggctgtggg tagcgcagcg
     151  ctggccgtca gggcgaccat cggagtagtg gaattcaata gggagtgtgt
     201  gcgtggggcg aggaggatcg tatctagcgg tggaaggtgc ttaatagtcc
     251  aatcccctta tggtaatcct aaccaaggat tgataagagg tgaggatgaa
     301  gaaattgata atgtggaaga gtcgactccg gaggagctaa ctcagttgat
     351  cgaggttaag gcggaagtgg atgggaagga ggtggttgtc tccaagaagc
     401  gtgtggtgaa caggcacttg agacaacgat tcgttcgctc cattgccatc
     451  gaagccaaaa atcactttgg tggtgacatc agtcccagca aggctaacta
     501  cctttctgtt tccaagtttt tgacggggaa atgcaaggag aggcatgttg
     551  tgcccgctca cactagagat tgtgtgagcg ctgccatggt actggtgttc
     601  acccctgacg tccacgagat caggatgatg gcagggttgg catctgatgc
     651  agcgtacgcg aggaaaatcg caatggcaag catactgaac aggaaagggt
     701  ggtgttggag gctaatggta aatccattgg atagggcaag atggtgggaa
     751  atgtggtgcg tcgtaaacgg gtttgactcc aacaaacccg tcacctttcc
     801  caaatagggg ggcctgttct acctcaatgg tgtggagacg aaaattcgtc
     851  gtggaggcca cccatcagtg attgaggtag acgggcaatg tcctccaaga
     901  gagagaaaac tctacgtaca gaatgccata accactggtt atgaatacag
     951  ggtccacaac cattcgtacg caaacctcag acgagggctc cttgagagag
    1001  tcttctatgt tgagcgcaac aaggagctag tcagctgtcc gcaacctgaa
    1051  cccggcagct ttaaagagat gggatacctg cgacgcaggt tccatagagt
    1101  gtgtggcaat catacccgga tctctgccaa tgatttggta gattgttatc
    1151  agggcaggaa gcgcacaatt tatgagaatg cagcagcgtc cctacttgat
    1201  agagctatcg agaggaagga tggcgatctc aagaccttta taaaggcgga
    1251  gaaattcaac gtaaatctga aaagtgatcc tgctcctcgg gtcatacagc
    1301  ccaggagccc tcgctacaat gtggagttgg gccggtactt aaagaagtat
    1351  gaacaccatg cttacaaagc cctggacaag atctgggggg ggccaacggt
    1401  catgaaagga tacactacag aggaggtagc acagcacatt tggagcgcat
    1451  ggaatcaatt ccagacacct gtagccatcg gatttgacat gtcaagattt
    1501  gatcagcacg tgtctgtagc cgcgctcgag ttcgaacatt catgctattt
    1551  ggcctgtttt gaaggggacg ctcacctcgc caatttgctt aagatgcaac
    1601  tggtgaatca tggcgtaggt tttgcgagca atggaatgtt gcgatacacc
    1651  aaggaagggt gcagaatgat cggagacatg aacactgcct tgggcaactg
    1701  tttgttagcg tgtcttatca ccaaacactt aatgaaaatc agaagcagac
    1751  tgatcaacaa tggggatgac tgcgtgctta tttgcgaaag aacagacatc
    1801  gactacgtcg tgagcaatct aacgacggga tggagtcgat ttggattcaa
    1851  ttgcatagca gaagaaccag tgtacgaaat ggaaaagatc agattctgcc
    1901  agatggcacc ggtgtttgat ggagcaggct ggctgatggt cagggaccca
    1951  ttggtgagca tgagtaaaga ttctcactcc ttggtacact ggaacaacga
    2001  aacaaacgca aaacaatggc taaaatcagt aggaatgtgc ggactgcgga
    2051  ttgccggggg ggttccgatt gtgcaagagt tctaccaaaa atacgttgaa
    2101  acagccggaa atgtgaaaga gaacaaaaat atcacagaga aaagtagttc
    2151  tgggttcttt atgatggcgg atcgcgctaa gcggggctat tctgcagtgt
    2201  ctgagatgtg ccgattcagt ttttaccagg cattcggtat tacaccagac
    2251  cagcagatcg cgttggaggg ggagattaga tctctcacca tcgacaccaa
    2301  tgtggggccc cagtgtgaag cggcagattc actatggata ttgaaccgga
    2351  agtaccagta gttgagaagc aaatgctcgc tgggaataga ggaaaacaaa
    2401  agacacgtag atcggtggcc aaggatgcca tccgcaaacc tgcatccgat
    2451  agtactaacg ggggtaattg ggttaatgtt gctgataaga ttgaggtgca
    2501  cattcacttc aacttttagt ttgcccccgt tggtaacctt aaatcagata
    2551  atagcgttgt cattttgtgg tcttctatta aacagcatct ctcgggcaga
    2601  aagagcttgc tattacaact actctgttga cagttctaaa caacaacaca
    2651  tttcgataag tacaccaaat ggaaaataaa ggagaaaaga tcgcgatgaa
    2701  tcccactgtg caaacattgg cgcagaaggg ggataagtta gccgtgaagt
    2751  tggtgacaag agggtgggcc tctctgagta cgaaccagaa gaggagagct
    2801  gaaatgcttg ctggatacac tccagcgatc ctagccttca caccccgacg
    2851  accacggatg acaaactctc ctccaagaac cagtaggaat tcaccaggac
    2901  aagctggaaa gtccatgacg atgagtaaga ccgaactgct atgcaccgtc
    2951  aaaggtacca caggtgttat cccaagcttt gaagactggg tcgtttcccc
    3001  ccgaaacgta gccgttttcc cccaactctc gctgctggcg accaacttca
    3051  ataagtaccg catcactgcg cttactgtga agtactcacc agcgtgtagc
    3101  ttcgagacca atgggagggt ggctctggga ttcaacgatg acgcttcgga
    3151  cacaccacca accaccaagg ttggatttta cgatctgggc aaacatgtgg
    3201  aaactgctgc acagacagct aaagatctag tgataccagt agacggcaaa
    3251  acccggttca tcagggactc ggctagtgat gatgccaaac tagtcgattt
    3301  tggacgatta gtcttgtcaa catacgggtt tgacaaggca gatactgtgg
    3351  tgggcgagtt gtttatacag tacacgattg tgctgagtga cccaaccaag
    3401  acggccaaaa tttcacaggc aagcaacgat aaggtgtcgg atggaccaac
    3451  gtatgtggtc ccttcggtta acggcaacga gctgcaacta agagtggtag
    3501  ccgcagggaa atggtgcatt atagtgcggg gcacggttga aggtggcttc
    3551  accaaaccca cacttattgg accaggaatc agcggtgatg tggactatga
    3601  aagtgccaga cctatcgcca tttgcgagtt ggtgacacaa atggagggcc
    3651  agatgttgaa aatcaccaag acctcagcag aacaaccact caaagtggtt
    3701  gtttatagga tgtgaatgca gaagaaaagt ttgatagaca cacacggcgg
    3751  gacgtgttgc tagagctgcc actctgcccg agatggatcg atattaacca
    3801  tctttggcaa cagcgtgtgt gatcaaccaa acctagtaac tgcgtagcat
    3851  ccgactgtaa cctgttctct gctgaatgcg agggtggcct cgtgatccca
    3901  aaccataaaa gaaaccaact tgttggtgga agggctagga agtaggatca
    3951  accactgttt attaattagg ggtaagagta ttcactgtac tctttccccg
    4001  ccc