Sequence of DPV Groundnut rosette virus

Groundnut rosette virus clone M16G3 orf3 mRNA, complete cds.

ACC No: AF202860

Dated: 2000-06-13 | Length: 789 | CRC: 1664910676

                !!NA_SEQUENCE 1.0
ID   AF202860   standard; RNA; VRL; 789 BP.
XX
AC   AF202860;
XX
SV   AF202860.1
XX
DT   13-JUN-2000 (Rel. 64, Created)
DT   13-JUN-2000 (Rel. 64, Last updated, Version 1)
XX
DE   Groundnut rosette virus clone M16G3 orf3 mRNA, complete cds.
XX
KW   .
XX
OS   groundnut rosette virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Umbravirus.
XX
RN   [1]
RP   1-789
RA   Deom C.M., Naidu R.A., Chiyembekeza A.J., Ntare B.R., Subrahmanyam P.;
RT   "Sequence Diversity within the Three Agents of Groundnut Rosette Disease";
RL   Phytopathology 90:214-219(2000).
XX
RN   [2]
RP   1-789
RA   Deom C.M., Naidu R.A., Chiyembekeza A.J., Ntare B.R., Subrahmanyam P.;
RT   ;
RL   Submitted (09-NOV-1999) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of Georgia, Plant Sciences Building, Athens, GA
RL   30602-7274, USA
XX
DR   SPTREMBL; Q9IM05; Q9IM05.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .789
FT                   /country="Malawi: Karonga"
FT                   /db_xref="taxon:47740"
FT                   /note="isolated from plant showing green rosette symptoms"
FT                   /organism="groundnut rosette virus"
FT                   /clone="M16G3"
FT   CDS             1. .789
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IM05"
FT                   /product="orf3"
FT                   /protein_id="AAF74545.1"
FT                   /translation="MDMVEHLSPERRDSTTASRGQWPVGIMSSIINVFASGKSRDTRGT
FT                   PRSSVWRGHRTGAPRDKPWGAYTPSRRPKGGVHPATASKDPNENIRGPSASTTHQKHWG
FT                   SVVPGKSCGGVHTQRTGRRTRRSGGMDTQQPAAQPKQRGATAAIPPERRAKIDGLLPPL
FT                   LDTFDGQIQGDAALLRYCVGALKRELRRRRKPVQLAHNVAASGGEPSSQLLDEAAKDAE
FT                   NLPGDGEGRAGKPVQQEVLHSGGSVPAVCADCGKPAANKW"
XX
SQ   Sequence 789 BP; 194 A; 220 C; 230 G; 145 T; 0 other;

AF202860  Length: 789  December 21, 2001 14:55  Type: N  Check: 307  ..

       1  atggacatgg ttgaacacct ctcccctgag cgaagggact ccaccacggc
      51  tagccgcgga caatggccgg tgggtatcat gtcaagcata atcaatgtct
     101  tcgctagtgg caaaagccgc gacacaaggg gaactcctcg aagctctgta
     151  tggcgaggtc accgtacagg agctccaaga gacaaacctt ggggtgctta
     201  caccccatcg aggagaccaa agggtggtgt tcaccccgct actgcctcca
     251  aagacccaaa cgagaatatc aggggtcctt cggcgtctac gacccaccag
     301  aaacactggg ggtctgttgt acctggaaaa agttgtggtg gtgttcacac
     351  ccaacgtacc ggacgacgca ccaggcgaag tggaggtatg gatacacaac
     401  agcctgctgc ccaacctaaa cagcgtgggg ccacggctgc gattccccct
     451  gaacggaggg ccaagattga tggcctttta ccccccctac tcgatacctt
     501  tgatggacaa atccaaggag atgccgcgct gcttcgctat tgtgtcggag
     551  ctcttaagcg cgagctacgt aggcggcgga agcccgttca gcttgctcat
     601  aatgtggcag cctcaggtgg agagcctagc tcacaactac ttgatgaggc
     651  cgccaaagat gcagaaaatc tgccggggga tggtgaagga cgcgctggga
     701  aacctgtcca gcaggaagtc ctacatagcg ggggcagtgt cccagcggtt
     751  tgcgcagact gcggcaagcc cgctgccaat aaatggtga