Sequence of DPV Groundnut rosette virus

Groundnut rosette virus clone N19G3 orf3 mRNA, complete cds.

ACC No: AF202864

Dated: 2000-06-13 | Length: 789 | CRC: -1352576651

                !!NA_SEQUENCE 1.0
ID   AF202864   standard; RNA; VRL; 789 BP.
XX
AC   AF202864;
XX
SV   AF202864.1
XX
DT   13-JUN-2000 (Rel. 64, Created)
DT   13-JUN-2000 (Rel. 64, Last updated, Version 1)
XX
DE   Groundnut rosette virus clone N19G3 orf3 mRNA, complete cds.
XX
KW   .
XX
OS   groundnut rosette virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Umbravirus.
XX
RN   [1]
RP   1-789
RA   Deom C.M., Naidu R.A., Chiyembekeza A.J., Ntare B.R., Subrahmanyam P.;
RT   "Sequence Diversity within the Three Agents of Groundnut Rosette Disease";
RL   Phytopathology 90:214-219(2000).
XX
RN   [2]
RP   1-789
RA   Deom C.M., Naidu R.A., Chiyembekeza A.J., Ntare B.R., Subrahmanyam P.;
RT   ;
RL   Submitted (09-NOV-1999) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, University of Georgia, Plant Sciences Building, Athens, GA
RL   30602-7274, USA
XX
DR   SPTREMBL; Q9IM02; Q9IM02.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .789
FT                   /country="Nigeria: Kofa"
FT                   /db_xref="taxon:47740"
FT                   /note="isolated from plant showing chlorotic rosette
FT                   symptoms"
FT                   /organism="groundnut rosette virus"
FT                   /clone="N19G3"
FT   CDS             1. .789
FT                   /codon_start=1
FT                   /db_xref="SPTREMBL:Q9IM02"
FT                   /product="orf3"
FT                   /protein_id="AAF74549.1"
FT                   /translation="MDMAQHPPQQRIDTTPASRGQWPVGIMSSVINVFASGKSCDSRGA
FT                   PRSSVRGGHRTGAPRNKPGGTHTPSRRPKGGVHPATTSKDPNKNIRSPPAPTPHKEHRG
FT                   PAIPGENRGGVHTTRARRRARRSGGMDPRQLTAQPQQRWAETKIPTERRAAIDGLLPPL
FT                   LNTLDGQIQGNAALLRYCVGAVKRELRRRWKPVQPAHHVAASSGKPSPQLSDEAARNAE
FT                   DLSRDGEGRAGKSVQQEVLHSGSSVPEVCADCGKLAANKW"
XX
SQ   Sequence 789 BP; 205 A; 224 C; 221 G; 139 T; 0 other;

AF202864  Length: 789  December 21, 2001 14:55  Type: N  Check: 3550  ..

       1  atggacatgg cgcaacaccc tccccaacag cgaatagaca ctaccccggc
      51  tagccgcgga caatggccgg tgggtatcat gtcaagtgta atcaatgtct
     101  tcgcaagtgg caaaagctgc gactcaaggg gagctcctcg aagctctgta
     151  cggggaggtc accgtacagg agctccaaga aacaaacctg ggggtactca
     201  caccccatcg aggagaccaa agggtggtgt tcaccccgct actacctcca
     251  aggacccaaa caagaatatc agaagtcctc cggcgcctac gccccacaaa
     301  gaacacaggg ggcctgctat acctggagaa aatcgtggtg gtgttcacac
     351  cacacgtgcc agacgacgcg ccaggcgaag tggaggtatg gatccacgac
     401  agcttactgc ccaacctcaa cagcgttggg ccgagactaa aattcccact
     451  gaacggaggg ccgcgattga tggccttcta ccccccttac tcaataccct
     501  tgatggacaa atccaaggga atgccgcgtt gcttcgctat tgtgtcggag
     551  ctgttaagcg cgagctacgt aggaggtgga agcccgttca gcctgcacat
     601  catgtggcag cctcaagtgg aaagcctagc ccacaattat ctgatgaggc
     651  cgcccgcaat gcagaagatc tgtcgaggga tggtgaagga cgcgctggga
     701  agtctgtcca gcaggaagtc ctacatagcg ggagcagtgt cccagaggtt
     751  tgcgctgact gcggcaaact cgccgccaat aaatggtga