Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus isolate 264 coat protein (CP) mRNA, partial cds.

ACC No: AF488692

Dated: 2005-04-15 | Length: 1134 | CRC: 1258747906

                !!NA_SEQUENCE 1.0
ID   AF488692   standard; mRNA; VRL; 1134 BP.
XX
AC   AF488692;
XX
SV   AF488692.1
XX
DT   03-APR-2002 (Rel. 71, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Melon necrotic spot virus isolate 264 coat protein (CP) mRNA, partial cds.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1134
RA   Diaz J.A., Nieto C., Moriones E., Aranda M.A.;
RT   "Spanish Melon Necrotic Spot Virus Isolate Overcomes the Resistance
RT   Conferred by the Recessive nsv Gene of Melon";
RL   Plant Dis. 86:694-694(2002).
XX
RN   [2]
RP   1-1134
RA   Diaz J.A., Nieto C., Moriones E., Aranda M.A.;
RT   ;
RL   Submitted (27-FEB-2002) to the EMBL/GenBank/DDBJ databases.
RL   Virologia, CSIC, Estacion Experimental La Mayora, Algarrobo Costa, Malaga
RL   29750, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1134
FT                   /country="Spain"
FT                   /db_xref="taxon:11987"
FT                   /mol_type="mRNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="264"
FT   CDS             <1. .>1134
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8QR62"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8QR62"
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AAM00908.1"
FT                   /translation="INNLPTVKLAKQALPLLANPKIVNKAIDVVPLVVQGGQKLSKAAK
FT                   RLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFIASVLPS
FT                   NDLTVNNGDVNVGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGSTSTGRV
FT                   SILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAVDRKLVD
FT                   FGQFLFATYSGAGDTAHGDLYVEYAVEFKDPQPIAGMVCMFDRSVSFSEVGSTIKGVNY
FT                   IADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVSSSGTSA
FT                   LTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSP"
XX
SQ   Sequence 1134 BP; 252 A; 263 C; 264 G; 355 T; 0 other;

AF488692  Length: 1134  December 20, 2005 16:49  Type: N  Check: 3639  ..

       1  attaacaatt tacccactgt gaagcttgct aagcaggctc tacccctgct
      51  agcgaaccct aaaattgtga ataaagctat agatgtggtt cctttggtcg
     101  tccaaggtgg tcagaaattg tccaaggccg ctaagcgatt gcttggtgct
     151  tatggaggca acatttcgta tactgagggt gccaaaccag gcgcaatatc
     201  agctcctgtc gctattagtc ggcgagtggc tggcatgaag cctaggtttg
     251  ttcgatcgga aggatctgta aagatagttc atagggagtt tattgcctct
     301  gttcttcctt cgaatgatct cactgttaat aatggtgatg tcaacgttgg
     351  caagtataga gtcaatccca gtaataacgc tttattcaca tggcttcagg
     401  gacaagcgca actatatgat atgtacaggt ttactcggct ccgtttcacc
     451  tatattccta ctaccggatc gacttccacc ggtcgtgtct ctatcctttg
     501  ggatagagat tctcaggacc ccctccctat tgatcgtgct gccattagct
     551  cttatgctca ttacgctgat tcagcgcctt gggctgagaa tgtcctagtg
     601  gttccttgtg acaatacgtg gaggtacatg aatgatacca atgccgtcga
     651  ccggaagttg gttgattttg ggcagttcct tttcgctact tattctggtg
     701  ctggtgacac cgcccatggt gatctttacg tcgagtatgc tgttgaattc
     751  aaggaccccc agcctatcgc tgggatggta tgtatgtttg atcgctctgt
     801  ctccttctct gaagttgggt ctactattaa gggagtcaat tatattgctg
     851  atcgtgatgt gataaccact gggggcaata ttggtgttaa catcaacatt
     901  cccgggactt atctcgttac gattgttctt aatgccacat cgattggttc
     951  cctcaccttc actggcaatt ctaaacttgt aggcaacagt cttaatgttt
    1001  ccagcagtgg tacatctgct cttacgttca cccttaactc cactggtgtg
    1051  cccaatagta gcaattcttc gttctctgtg ggtaccgttg ttgcattgac
    1101  tagggtgcgt atgacgatca ctcgctgctc tcca