Sequence of DPV Carnation mottle virus

Carnation mottle virus p27 gene, p7 gene, p9 gene and CP gene, genomic RNA

ACC No: AJ304989

Dated: 2005-04-15 | Length: 4002 | CRC: 1460549308

                !!NA_SEQUENCE 1.0
ID   CMO304989  standard; genomic RNA; VRL; 4002 BP.
XX
AC   AJ304989;
XX
SV   AJ304989.1
XX
DT   16-JAN-2001 (Rel. 66, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Carnation mottle virus p27 gene, p7 gene, p9 gene and CP gene, genomic RNA
XX
KW   coat protein; cp gene; movement protein; p27 gene; p7 gene; P9 gene;
KW   RNA polymerase.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4002
RA   Pallas V.;
RT   ;
RL   Submitted (11-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Pallas V., Biologia del estres, Instituto de Biologia Molecular y Celular
RL   de Plantas-CSIC, Avenida de los Naranjos s/n, 46022 Valencia, SPAIN.
XX
RN   [2]
RX   DOI; 10.1074/jbc.M100706200.
RX   MEDLINE; 21264602.
RX   PUBMED; 11279121.
RA   Vilar M., Esteve V., Pallas V., Marco J.F., Perez-Paya E.;
RT   "Structural properties of carnation mottle virus p7 movement protein and
RT   its RNA-binding domain.";
RL   J. Biol. Chem. 276(21):18122-18129(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4002
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT                   /isolate="Dixie"
FT   CDS             69. .806
FT                   /db_xref="UniProt/TrEMBL:Q9DJV5"
FT                   /gene="p27"
FT                   /product="RNA polymerase"
FT                   /protein_id="CAC22322.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GARRIVSSGGRCLIVQSPYGNPNQGLIRGEDEEIDNVEESTPEELTQLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFVRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYGRKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEMWCVVNGFDSNKPVTFPK"
FT   CDS             2333. .2518
FT                   /db_xref="GOA:Q9DJV4"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q9DJV4"
FT                   /note="The central region contains an RNA-binding motif"
FT                   /gene="p7"
FT                   /product="movement protein"
FT                   /protein_id="CAC22323.1"
FT                   /translation="MDIESEVPVVEKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   CDS             2424. .2678
FT                   /db_xref="UniProt/TrEMBL:Q9DJV3"
FT                   /gene="p9"
FT                   /product="movement protein"
FT                   /protein_id="CAC22324.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   CDS             2668. .3714
FT                   /db_xref="GOA:Q9DJV2"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9DJV2"
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAC22325.1"
FT                   /translation="MENKGERIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLAMNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSTSDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKINKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 4002 BP; 1134 A; 865 C; 1087 G; 916 T; 0 other;

 AJ304989  Length: 4002  April 19, 2005 08:52  Type: N  Check: 9331  ..

       1  gggtaagctg gcgggcaaac ctatctctat cttcattaca ttatatattc
      51  taaccatctg ctttcactat gggattaccc agtctactag tggaaggcgt
     101  tattggatgc actctagtcg gtggtttggt ggctgtgggt agcgcagcgc
     151  tggccgttcg ggcgaccatc ggtgttgtag aattcaatag ggagtgtgtg
     201  cgcggggcga gaaggatcgt atctagcgga ggaaggtgct tgatagtcca
     251  atccccttat ggtaatccta accaaggatt gataagaggc gaggacgaag
     301  aaattgacaa tgtggaggag tcaacaccgg aggaattgac tcagttgatt
     351  gaggtcaagg cggaagtgga tgggaaagag gtggtcgtct ccaagaagcg
     401  tgtagtaaac aggcacttga gacaacgatt cgttcgctcc atagccatcg
     451  aagccaaaaa tcactttggt ggcgacatca gccctagcaa ggccaactat
     501  ctttccgttt ccaagttttt aacggggaaa tgcaaggaaa gacatgttgt
     551  gcccgctcac actagagatt gtgtgagtgc agctatggtg ctggtattca
     601  cccccgacgt ccacgagatc aggatgatgg caggattggc gtctgacgca
     651  gcgtacggaa gaaagatcgc aatggcaagc atactgaaca ggaaaggatg
     701  gtgttggagg ctaatggtaa atccattaga tagggcaaga tggtgggaaa
     751  tgtggtgcgt tgtaaacggg tttgactcca acaaacccgt cacctttccc
     801  aaataggggg gcctgttcta cctcaatggt gtggagacga aaattcgtcg
     851  tggaggccac ccatcagtga ttgaggtaga cgggcaatgt cctcccaaag
     901  agagaaaact ctacgtacag aatgccataa ccactggtta tgaatacagg
     951  gtccacaacc attcgtacgc aaacctcaga agagggctcc ttgagagagt
    1001  tttctatgtt gagcgcaaca aggagctagt cagctgtccg caacctgaac
    1051  ccggcagctt taaagagatg ggatacctgc gacgcaggtt ccatagagtg
    1101  tgtggcaatc attcccggat ctctgccaat gatttggtag attgttatca
    1151  gggcaggaaa cgcacaatct atgagaatgc agcagcgtcc ctactcgata
    1201  gagctatcga aaggaaggat ggcgatctta aaacctttat caaggcggag
    1251  aaattcaacg tgaatctgaa aagtgatcct gctcctcggg ttatacagcc
    1301  taggagccct cgctacaatg tggagttggg ccggtactta aagaagtatg
    1351  aacaccatgc ttacaaagcc ttagacaaga tctggggagg accaacagtc
    1401  atgaaaggat acactacaga ggaggtagca cagcacattt ggagcgcatg
    1451  gaatcaattc cagacacctg tagccatagg atttgacatg tcaagattcg
    1501  atcagcacgt gtctgtagcc gcgctcgagt tcgaacattc atgctatttg
    1551  gcctgttttg aaggggacgc tcatctcgcc aacttgctta agatgcaact
    1601  ggtgaatcat ggcgtgggtt ttgcgagcaa tggaacgttg cgatacacaa
    1651  aggaagggtg tagaatgagc ggcgacatga acactgcctt gggcaactgt
    1701  ttgttagcct gtcttatcac caaacactta atgaaaatca ggagcagact
    1751  gatcaacaat ggggatgact gcgtgcttat ttgcgaaaga acagacatcg
    1801  actacgtcgt gagtaattta acgacgggat ggagtcgatt tggtttcaat
    1851  tgcatagcag aagagccagt gtacgaaatg gaaaagatca ggttctgcca
    1901  gatggcaccg gtgtttgatg gagcaggctg gctgatggtc agggacccct
    1951  tggtgagcat gagcaaggat tctcactcct tagtgcattg gaacaacgaa
    2001  acgaacgcaa gacaatggct gaagtcagta ggaatgtgcg gtctgcggat
    2051  tgccgggggg gttccagttg tgcaagagtt ctaccagaaa tacgttgaaa
    2101  cagccggaaa tgtgaaagag aacaaaaata tcacagagaa gagcagttct
    2151  gggttcttta tgatggcgga tcgcgctaag cggggctatt ctgctgtgtc
    2201  tgaggagtgt cgatttagct tctaccaggc attcggcatc acgccagacc
    2251  agcagatcgc gttggagggg gagatcaggt ctctcactat taacaccaac
    2301  gtggggcccc agtgtgaagc ggcagattca ctatggatat tgaatcggaa
    2351  gtaccagtag ttgaaaagca aatgctcgct gggaacagag gaaaacaaaa
    2401  gacacgtaga tcggtggcca aggatgccat ccgtaaacct gcatctgata
    2451  gtactaacgg gggtaattgg gttaatgttg ctgataagat tgaggtgcac
    2501  attcacttca acttttagtt tgcccccact ggtaacttta aatcagataa
    2551  tagcgttgtc attttgtggt cttctgttaa acagcatctc tcgggcagaa
    2601  agagcgtgct attacaacta ctctgttgat agttctaaac aacaacacat
    2651  ttcgataagt acaccaaatg gaaaataaag gagaaaggat cgcgatgaat
    2701  cccactgtgc aaacattggc gcagaagggg gacaagttag ccgtgaagtt
    2751  ggtgacaaga ggatgggcct ctctgagtac gaaccagaag aggagagctg
    2801  aaatgcttgc tggatacact ccagcgatcc tagccttcac cccccgacga
    2851  ccacggatga cgaaccctcc tccaagaacc agtaggaatt caccaggaca
    2901  agctggaaag tccatgacga tgagtaagac cgaactatta agcaccgtca
    2951  aaggtaccac gggtgttatc ccaagctttg aagactgggt cgtttccccc
    3001  cgaaacgtag ccgtcttccc tcaactctcg ctgctagcga tgaacttcaa
    3051  caagtaccgc attactgcgc tcactgtgaa gtactcaccc gcgtgcagct
    3101  tcgagaccaa tgggagggtg gctctgggat tcaacgatga cgcttcggac
    3151  acaccaccaa ccaccaaggt tggattttac gatctgggca aacatgtgga
    3201  aactgctgca cagacagcta aggatctagt gataccagta gacggcaaaa
    3251  cccggttcat cagggactcg actagtgatg atgccaaact agtcgatttt
    3301  ggacgaatag tcttgtcaac atacgggttt gacaaggctg acactgtggt
    3351  gggcgaattg tttatacagt acacgattgt gctgagtgac ccaaccaaga
    3401  cggccaaaat ttcacaggca agcaacgata aggtgtcgga cggaccaacg
    3451  tatgtggtcc cttcggtcaa tggcaacgag ctacaactaa gagtggtagc
    3501  agctgggaaa tggtgcatta tagtgcgggg tacggttgag ggaggcttca
    3551  ccaaacccac acttattggg ccaggaatca gcggtgatgt ggactatgaa
    3601  agtgccagac ctatcgccat ttgtgaattg gtgacacaaa tggagggcca
    3651  gatattgaaa atcaacaaaa cctcagcaga acaaccactc caatgggttg
    3701  tttataggat gtgaatgcaa cagaaaagtt tgttagacac acacggcggg
    3751  acgtgttgct ggagctgcca ctccgcccaa gatggatcga tattaaccat
    3801  ctttggcaac agcgtgcgtg actaattgaa cctagtaatt gcatagcatt
    3851  cgactgtaac ctgttctctg ctgaacgcga gggtggcctc gtgatcccaa
    3901  accataaaag aaaccaactt gttggtggaa gggcttggaa gtaggatcaa
    3951  ccactgttta ttaattaggg gtgggagtat tcactgtact ctttccccgc
    4001  cc