Sequence of DPV Carnation mottle virus

Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate sp-i

ACC No: AJ309507

Dated: 2005-04-15 | Length: 1382 | CRC: -1136371055

                !!NA_SEQUENCE 1.0
ID   CMO309507  standard; genomic RNA; VRL; 1382 BP.
XX
AC   AJ309507;
XX
SV   AJ309507.1
XX
DT   30-JAN-2001 (Rel. 66, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Carnation mottle virus p7 gene, p9 gene and cp gene, genomic RNA, isolate
DE   sp-i
XX
KW   coat protein; cp gene; movement protein; p7 gene; P9 gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1382
RA   Pallas V.;
RT   ;
RL   Submitted (29-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Pallas V., Biologia del estres, Instituto de Biologia Molecular y Celular
RL   de Plantas-CSIC, Avenida de los Naranjos s/n, 46022 Valencia, SPAIN.
XX
RN   [4]
RX   DOI; 10.1007/s007050170051.
RX   MEDLINE; 21578632.
RX   PUBMED; 11722023.
RA   Canizares M.C., Marcos J.F., Pallas V.;
RT   "Molecular varaibility of twenty-one geographically distinct isolates of
RT   Carnation mottle virus (CarMV) and phylogenetic relationships within the
RT   Tombusviridae family";
RL   Arch. Virol. 146(10):2039-2051(2001).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1382
FT                   /country="Spain"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT                   /isolate="sp-i"
FT                   /variety="Indios"
FT   CDS             1. .186
FT                   /db_xref="GOA:Q999Z8"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q999Z8"
FT                   /note="The central region contains an RNA-binding motif"
FT                   /gene="p7"
FT                   /product="movement protein"
FT                   /protein_id="CAC27498.1"
FT                   /translation="MDIEPEVSVVGKQTLAGNRGKQKTRXSVAKDAIRKPASDSTNGGI
FT                   WVNVADKIEVHIHFNF"
FT   CDS             92. .346
FT                   /db_xref="UniProt/TrEMBL:Q999Z7"
FT                   /gene="p9"
FT                   /product="movement protein"
FT                   /protein_id="CAC27499.1"
FT                   /translation="MPSANLHLIVLTGVFGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
FT   CDS             336. .1382
FT                   /db_xref="GOA:Q999Z6"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q999Z6"
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /protein_id="CAC27500.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNHKRRAE
FT                   MLAGYTPAILAFTPRRPRMINPPPRTSRNSPGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALRFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDGAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFAKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1382 BP; 413 A; 310 C; 343 G; 315 T; 1 other;

 AJ309507  Length: 1382  April 19, 2005 08:56  Type: N  Check: 5550  ..

       1  atggatattg aaccggaagt atcagtagtt ggaaagcaaa cgctcgctgg
      51  gaatagagga aaacagaaga cacgtanatc ggtggccaag gatgccatcc
     101  gcaaacctgc atctgatagt actaacgggg gtatttgggt taatgttgct
     151  gataagattg aggtgcacat tcacttcaac ttttagtttg cccccactgg
     201  taactttaaa tcagataata gcgttgtcat tttgtggtct tctattaaac
     251  agcatctctc gggcagaaag agcttgctat tacaactact ctgttgatag
     301  ttctaaacaa caacacattt caataagtac accaaatgga aaataaagga
     351  gaaaagatcg cgatgaatcc cactgtgcaa acattggcgc agaaggggga
     401  caagttagcc gtgaagttgg tgacaagagg gtgggcctct ctgagtacga
     451  accataagag gagagctgaa atgcttgctg gatatactcc agcgatccta
     501  gcctttacac cccgacgacc acgtatgata aaccctcctc caagaaccag
     551  taggaattca ccaggacaag ctggaaagtc catgacgatg agtaagaccg
     601  aactactatg caccgtcaaa ggtaccacag gtgttatccc aagctttgaa
     651  gactgggtcg tttccccccg aaacgtagcc gttttccctc aactctcgtt
     701  gctggcgacc aacttcaaca agtaccgcat cactgcgctt actgtgaagt
     751  actcaccagc atgtagcttc gagaccaatg ggagggtggc tctaagattc
     801  aacgatgacg cttcggacac accaccaacc accaaggttg gattctacga
     851  tctgggcaaa catgtggaaa ctgctgcaca aacagctaaa gatctagtga
     901  taccagtaga cggcaaaacc cggttcatca gggactcggc tagtgatggt
     951  gccaaactag tcgattttgg acgaatagtc ttgtcaacat acggatttga
    1001  caaggcggac actgtggtgg gcgaattatt tatacagtac acgatcgtgc
    1051  tgagtgaccc aaccaagacg gccaaaattt cacaggcaag caacgataag
    1101  gtgtcggatg gaccaacgta tgtggtccct tcggttaatg gcaacgagct
    1151  acagctacga gtggtagccg ctgggaaatg gtgcattata gtgcggggta
    1201  cggttgaagg tggcttcgcc aaacccacac ttattggacc aggaatcagt
    1251  ggtgatgtag actatgaaag tgccagacct atcgccattt gtgagttggt
    1301  gacacaaatg gagggccaga tattgaaaat caccaagacc tcagcagaac
    1351  aaccactcca atgggttgtt tataggatgt ga