Sequence of DPV Carnation mottle virus

Carnation mottle virus cp gene for coat protein, isolate Yunnan, genomic RNA

ACC No: AJ489479

Dated: 2005-04-15 | Length: 1047 | CRC: -1548566045

                !!NA_SEQUENCE 1.0
ID   TOM489479  standard; genomic RNA; VRL; 1047 BP.
XX
AC   AJ489479;
XX
SV   AJ489479.1
XX
DT   11-JUN-2002 (Rel. 72, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Carnation mottle virus cp gene for coat protein, isolate Yunnan, genomic
DE   RNA
XX
KW   coat protein; cp gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1047
RA   KONG B.;
RT   ;
RL   Submitted (10-JUN-2002) to the EMBL/GenBank/DDBJ databases.
RL   KONG B., Virology Department, Key Lab. For Plant Pathology in Yunnan, Key
RL   lab. for plant pathology of Yunnan, Kunming, Yunnan, P.R. China, Yunnan
RL   province, CHINA.
XX
RN   [2]
RA   Kong B.;
RT   "The clong and sequences anysis of gene of the isolation of Carnation
RT   mottle virus in Yunnan province";
RL   Thesis (2002), Department of Virology, Key labortory for plant pathology of
RL   Yunnan province, Kunming, China.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1047
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT   CDS             1. .1047
FT                   /db_xref="GOA:Q8JJU7"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q8JJU7"
FT                   /gene="cp"
FT                   /product="coat protein"
FT                   /protein_id="CAD33797.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILASTPRRPRLTNPPPRTSRNSPGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLVGPGISGDVDYESARPIAICELVTQMEGQILKIAKTSAEQP
FT                   LQVVVYRM"
XX
SQ   Sequence 1047 BP; 298 A; 247 C; 282 G; 220 T; 0 other;

 AJ489479  Length: 1047  April 19, 2005 08:50  Type: N  Check: 828  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaaacatt
      51  ggcgcagaag ggggacaagt tagccgtgaa gttggtgaca cgagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgctggatac
     151  actccagcga tcctagcctc cacaccccga cgaccacgac tgacgaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaacta ttatgcaccg tcaaaggtac cacaggtgtt
     301  atcccaagtt ttgaagactg ggtcgtttcc ccccgaaacg tagccgtttt
     351  ccctcagctc tcgctgctgg cgaccaactt caataagtat cgcatcactg
     401  cgcttactgt gaagtactcc ccagcgtgta gcttcgagac caatgggagg
     451  gtggctctgg gattcaacga tgacgcttcg gatacaccac caaccaccaa
     501  ggttggattt tacgatctgg gcaaacatgt ggaaactgct gcacagacag
     551  ccaaagatct agtgataccg gtagacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttggacgaa tagtcttgtc
     651  aacatacggg tttgacaagg cagatactgt ggtgggcgaa ttgtttatac
     701  agtacacgat tgtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggatggacca acgtatgtag tcccttcggt
     801  taacggcaac gagctacaac taagggtggt ggccgctggg aaatggtgca
     851  ttatagtgcg gggaacggtt gaaggtggct tcaccaaacc cacacttgtt
     901  gggccaggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgag ttggtgacac aaatggaggg ccagatattg aaaatcgcca
    1001  agacctcagc agaacaacca ctccaagtgg ttgtttatag gatgtga