Sequence of DPV Pelargonium flower break virus

Pelargonium flower break carmovirus complete genome

ACC No: AJ514833

Dated: 2004-06-11 | Length: 3923 | CRC: -1822743019

                !!NA_SEQUENCE 1.0
ID   PFL514833  standard; mRNA; VRL; 3923 BP.
XX
AC   AJ514833;
XX
SV   AJ514833.1
XX
DT   28-AUG-2003 (Rel. 77, Created)
DT   11-JUN-2004 (Rel. 80, Last updated, Version 2)
XX
DE   Pelargonium flower break carmovirus complete genome
XX
KW   coat protein; CP gene; p12 gene; p27 gene; p7 gene; p86 gene; p99 gene.
XX
OS   Pelargonium flower break virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3923
RA   Hernandez C.;
RT   ;
RL   Submitted (25-OCT-2002) to the EMBL/GenBank/DDBJ databases.
RL   Hernandez C., Inst. de Biologia Mol. y Cel. de Plantas, Csic, Avenida de
RL   los Naranjos S/N, 46022 Valencia, SPAIN.
XX
RN   [2]
RA   Rico P., Hernadez C.;
RT   "Complete nucleotide sequence and genome organization of Pelargonium flower
RT   break virus";
RL   Arch. Virol. 149:641-651(2004).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3923
FT                   /country="Spain:Madrid"
FT                   /db_xref="taxon:35291"
FT                   /mol_type="mRNA"
FT                   /virion
FT                   /organism="Pelargonium flower break virus"
FT                   /isolate="MZ10"
FT                   /lab_host="Chenopodium quinoa"
FT                   /specific_host="Pelargonium zonale"
FT   CDS             33. .2648
FT                   /note="read through stop codons"
FT                   /transl_except=(pos:762. .764,aa:OTHER)
FT                   /transl_except=(pos:2301. .2303,aa:OTHER)
FT                   /gene="p99"
FT                   /product="p99 protein"
FT                   /function="unknown"
FT                   /protein_id="CAD55834.1"
FT                   /translation="MLRFGSQLVVGSTLIGGLTAVGLAGLSVRATIGVVEFNLRCARVV
FT                   GDIIRDPFNALPSAPLFPGPSVEVFAEEVRKDLEPELEAKDYLVIHEEKEMDEEGKSKV
FT                   VRQRSTVNRHKKGRFVHRLVCDGKNHFGGTPSASRANELAVMKYLVGKCREHHLVVQHT
FT                   REVCSLAMAAIFTPDHHEVNMVREMNSHAAYRRRVALADASRVHSWQQELLRSPLSWNA
FT                   WGRAWWIANGLPDREPVRFTKXGGLFCLEGVETGVRRGTHPQMIEVEKNSPPKLRKLFA
FT                   QRLVSSGVEYRVHNHSFQNLRRGLLERVFYVEENKQLVSCPCPEKGAFKEMGYLRKQFV
FT                   RLTPKHARISAKEFVDCYHGRKKSVYEFAAMTLSERPLDRKDASLKTFIKAEKFCKADP
FT                   APRVIQPRSPRYNVELGRYLKKFEHTAYRTLDKIWGGKTVMKGYSVDEIGKHISEAWDS
FT                   FHSPVAVGFDMSRFDQHVSVPALQFEHSCYLACFPGDQHLAELLSWQLKNSGVGFASNG
FT                   MVRYKKDGCRMSGDMNTALGNCLLACLITRHLMKDINCRLVNNGDDCVLFLDKKDLPFV
FT                   VSNLTTGWRRFGFKCIAEEPVYELEHVRFCQMAPVYDGSQYVMLRDPFVSMSKDSFSLT
FT                   HWNTTKNAKQWMKSVGICGERITGGLPVVQEYYRKYQEIAGDVKFSHSLEITSSGTYRL
FT                   AQNSSRAYGSVSEMARFSFFLAFGVIPDAQIALEKHIRDMPVAAEFGPDESLADHTIEW
FT                   LLKXSFLIWVVIMRLTCQWEDVGTGVNRRVRYPSQRTLSPNGHLMVVMGVLGLLWLRPF
FT                   RSIYTSTFSMPPLINLQHILNLTLLSLILSSFILAERVTHNHYSNDNSKAQYIRISTGQ
FT                   "
FT   CDS             33. .2303
FT                   /note="read through stop codon"
FT                   /transl_except=(pos:762. .764,aa:OTHER)
FT                   /gene="p86"
FT                   /product="p86 protein"
FT                   /function="putative RNA dependent RNA polymerase"
FT                   /protein_id="CAD55835.1"
FT                   /translation="MLRFGSQLVVGSTLIGGLTAVGLAGLSVRATIGVVEFNLRCARVV
FT                   GDIIRDPFNALPSAPLFPGPSVEVFAEEVRKDLEPELEAKDYLVIHEEKEMDEEGKSKV
FT                   VRQRSTVNRHKKGRFVHRLVCDGKNHFGGTPSASRANELAVMKYLVGKCREHHLVVQHT
FT                   REVCSLAMAAIFTPDHHEVNMVREMNSHAAYRRRVALADASRVHSWQQELLRSPLSWNA
FT                   WGRAWWIANGLPDREPVRFTKXGGLFCLEGVETGVRRGTHPQMIEVEKNSPPKLRKLFA
FT                   QRLVSSGVEYRVHNHSFQNLRRGLLERVFYVEENKQLVSCPCPEKGAFKEMGYLRKQFV
FT                   RLTPKHARISAKEFVDCYHGRKKSVYEFAAMTLSERPLDRKDASLKTFIKAEKFCKADP
FT                   APRVIQPRSPRYNVELGRYLKKFEHTAYRTLDKIWGGKTVMKGYSVDEIGKHISEAWDS
FT                   FHSPVAVGFDMSRFDQHVSVPALQFEHSCYLACFPGDQHLAELLSWQLKNSGVGFASNG
FT                   MVRYKKDGCRMSGDMNTALGNCLLACLITRHLMKDINCRLVNNGDDCVLFLDKKDLPFV
FT                   VSNLTTGWRRFGFKCIAEEPVYELEHVRFCQMAPVYDGSQYVMLRDPFVSMSKDSFSLT
FT                   HWNTTKNAKQWMKSVGICGERITGGLPVVQEYYRKYQEIAGDVKFSHSLEITSSGTYRL
FT                   AQNSSRAYGSVSEMARFSFFLAFGVIPDAQIALEKHIRDMPVAAEFGPDESLADHTIEW
FT                   LLK"
FT   CDS             33. .764
FT                   /gene="p27"
FT                   /product="p27 protein"
FT                   /function="putative polymerase associated protein"
FT                   /protein_id="CAD55836.1"
FT                   /translation="MLRFGSQLVVGSTLIGGLTAVGLAGLSVRATIGVVEFNLRCARVV
FT                   GDIIRDPFNALPSAPLFPGPSVEVFAEEVRKDLEPELEAKDYLVIHEEKEMDEEGKSKV
FT                   VRQRSTVNRHKKGRFVHRLVCDGKNHFGGTPSASRANELAVMKYLVGKCREHHLVVQHT
FT                   REVCSLAMAAIFTPDHHEVNMVREMNSHAAYRRRVALADASRVHSWQQELLRSPLSWNA
FT                   WGRAWWIANGLPDREPVRFTK"
FT   CDS             2288. .2494
FT                   /gene="p7"
FT                   /product="p7 protein"
FT                   /function="putative movement protein"
FT                   /protein_id="CAD55837.1"
FT                   /translation="MASKVIVPDLGSDNEIDVSVGGRGNRGKQKGKISVAKDAVSKRTS
FT                   DGGNGGSWVVVAETVSVNIHFNF"
FT   CDS             2328. .2648
FT                   /gene="p12"
FT                   /product="p12 protein"
FT                   /function="putative movement protein"
FT                   /protein_id="CAD55838.1"
FT                   /translation="MRLTCQWEDVGTGVNRRVRYPSQRTLSPNGHLMVVMGVLGLLWLR
FT                   PFRSIYTSTFSMPPLINLQHILNLTLLSLILSSFILAERVTHNHYSNDNSKAQYIRIST
FT                   GQ"
FT   CDS             2650. .3687
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CAD55839.1"
FT                   /translation="MDAYKNDPIVRQAVAKGVAWAAKLNTRGWSSLTTQQKKAARSALS
FT                   VIQSPAVVVPRRTRVRNPVPAGLKSGNGKAGKSSTLTRSEFICNVSSTTGVTPTFQSWI
FT                   INPREVKSFPQSSVCSVGYNKYRITDFRIRFSTSCSDTMNGKVAIGFTPDSSDPVPVDK
FT                   SQLYGMQVYADTPAKESVTLKTAADNTIRFLRDSSSDDAKLVDYGRVVLATYGFDSTAP
FT                   SVIGELFFEYTVVYLDPTYVVALTQHGTLTTSSGPPYATLTTTATSTSMELNTHGKWLV
FT                   VWVSADEVINSPVISGSGASGSVTVVSDAQTTVVAVVTANLPGAIISNTSTAAPSSLEW
FT                   YVSRL"
XX
SQ   Sequence 3923 BP; 992 A; 927 C; 1084 G; 920 T; 0 other;

 AJ514833  Length: 3923  June 15, 2004 08:41  Type: N  Check: 2979  ..

       1  gggatacctt acactcggta tctggttcca acatgctacg attcggatct
      51  cagttggtgg tgggttccac cttaatcggt ggtctcactg ctgtcgggct
     101  ggcaggcctg agcgtgcgtg ctacaatagg tgtagtggaa ttcaacctcc
     151  gctgtgctag agtggtgggt gacattatac gtgacccatt taatgccctc
     201  ccttcggccc ctctattccc cgggcccagc gttgaggttt tcgctgagga
     251  ggtgaggaag gacctcgagc cggagcttga ggctaaggat tacctcgtca
     301  tccacgagga aaaagaaatg gatgaggagg ggaagagcaa ggtggttagg
     351  cagaggtcta ctgtcaaccg ccacaagaag ggccggtttg tacaccggct
     401  agtctgtgat gggaaaaacc actttggtgg gaccccttca gctagccggg
     451  ccaacgagct ggcagtgatg aagtatctcg tgggtaagtg ccgcgagcac
     501  cacttagtgg tgcagcacac ccgcgaagtc tgctctctgg cgatggctgc
     551  catttttacc ccggaccacc atgaagtaaa catggttagg gaaatgaaca
     601  gccacgccgc ctaccgaaga agggtagccc ttgcagatgc ctccagagtc
     651  catagctggc agcaggagct actccgctca cccctgagtt ggaacgcttg
     701  ggggagggcg tggtggatag ccaacgggct tcctgacagg gagcctgttc
     751  ggttcaccaa ataggggggt cttttctgcc tcgagggtgt tgaaacagga
     801  gtccgtaggg ggacgcaccc acagatgatc gaggtagaga aaaactcccc
     851  cccgaaactt aggaaactct tcgcccaacg attggttagc agtggagttg
     901  aataccgcgt gcataaccac tcgtttcaaa acctaaggcg aggtctgctt
     951  gagagagttt tctacgtgga agaaaacaag cagttagtgt cgtgtccctg
    1001  tccggaaaaa ggggccttta aggagatggg ttacctacga aagcagttcg
    1051  ttagacttac tcccaaacat gccaggatct cagcaaagga atttgttgat
    1101  tgctatcatg gtaggaagaa gagtgtctac gagtttgcag ccatgaccct
    1151  ttctgagagg cctttggacc gcaaggatgc cagcttgaag acgttcataa
    1201  aggccgagaa attttgcaag gccgacccag ctccccgggt tatacaacca
    1251  agaagtccgc gctataacgt tgaattaggc cgatatctca agaaattcga
    1301  acacacggcc tacagaacgc tggacaaaat ctggggagga aagaccgtaa
    1351  tgaaagggta ctctgtagat gagataggga aacatatctc agaggcgtgg
    1401  gattcattcc actctccggt tgctgtcgga ttcgacatga gccggttcga
    1451  ccagcacgtt agtgtgcctg cgcttcaatt cgaacacagt tgttaccttg
    1501  cctgttttcc cggagatcag catttggcgg aactcttgag ctggcagctc
    1551  aagaattctg gtgtagggtt cgcgtcaaat ggaatggtca gatataagaa
    1601  ggatgggtgt agaatgtctg gagacatgaa cactgcactg ggaaactgcc
    1651  tattggcttg cctcataacg aggcacctca tgaaggacat aaattgtcga
    1701  ctcgtcaata acggggatga ctgtgtattg ttcttggaca agaaggacct
    1751  cccattcgtc gtgagtaatt taacgacggg ctggcgtagg tttgggttca
    1801  agtgcattgc agaggagcca gtatacgagc tagagcacgt gaggttttgc
    1851  cagatggccc cagtgtatga tggatcgcaa tacgtcatgt tgcgtgatcc
    1901  gtttgtgtcc atgtcaaaag atagtttctc actcacccat tggaacacca
    1951  caaagaatgc caaacaatgg atgaaatccg tgggcatctg tggtgagagg
    2001  attacaggtg ggttaccagt tgtgcaagaa tactacagga agtaccagga
    2051  aattgctgga gacgtgaagt tctctcattc cctagagata acttcatcag
    2101  gaacgtacag gttagcccag aattcttctc gggcctatgg ttcagttagc
    2151  gagatggcgc gttttagttt cttcctggcg tttggagtta tcccagatgc
    2201  ccagattgcc ttagagaaac acataagaga catgcccgtc gcagctgaat
    2251  ttgggcccga tgaaagtctg gcagaccaca caattgaatg gcttctaaag
    2301  tgatcgttcc tgatttgggt agtgataatg agattgacgt gtcagtggga
    2351  ggacgtggga acaggggtaa acagaagggt aagatatccg tcgcaaagga
    2401  cgctgtctcc aaacggacat ctgatggtgg taatgggggt tcttgggttg
    2451  ttgtggctga gaccgtttcg gtcaatatac acttcaactt ttagcatgcc
    2501  ccctctgata aacctccagc acatattgaa tcttactttg ttgtccctga
    2551  ttctaagttc tttcatcttg gcagagagag taacgcacaa tcactactca
    2601  aacgacaaca gcaaagcgca atacatacgg atctcaactg ggcaataaca
    2651  tggacgccta caagaatgac ccaatagtta ggcaggcagt ggcaaaggga
    2701  gtagcttggg cggctaagct gaacactaga gggtggtctt cattgacaac
    2751  ccaacagaag aaggctgcgc gctcagctct gtctgtgata caatccccag
    2801  cggtggttgt acctcgcaga accagagtac gaaacccagt acccgcgggc
    2851  ctgaaatcag ggaatggcaa ggcagggaaa agctcaactc taacccgatc
    2901  ggagtttatc tgcaacgtat cgagcacaac cggggtgacc ccgactttcc
    2951  aatcatggat tataaatcct agggaggtca aaagtttccc acaatcttcc
    3001  gtctgctcgg ttggctacaa caagtacagg atcacggact tcaggattag
    3051  gttttctact tcctgttccg acactatgaa tgggaaggtg gccattggct
    3101  tcactcctga ctctagcgat ccggttcctg ttgataagtc acagctgtac
    3151  gggatgcagg tgtatgccga cactccagca aaggagtcgg tcaccttgaa
    3201  gacggctgca gataacacga ttaggttcct gcgggattca tccagcgatg
    3251  atgccaagct ggtggattat ggccgcgtag ttttagccac atacggtttc
    3301  gatagcacag ctccatcagt aataggagag ctgttcttcg agtacaccgt
    3351  agtttatctc gaccctacct atgtcgtggc tttaacacaa catggcacgt
    3401  tgaccacctc atctggcccc ccatatgcta ccttgaccac cactgccact
    3451  tcaacatcca tggaattaaa cacccatgga aagtggctag tggtttgggt
    3501  ctcggcagac gaggtgatca actctccggt tatatccggg tccggggcaa
    3551  gcggatccgt aactgtcgtt agcgacgcac agactactgt tgttgcagtg
    3601  gttaccgcaa acttgccagg cgccatcatt tccaacactt caaccgctgc
    3651  cccttcgtca ctggagtggt atgtatctag gctatgagag ggcagtcacc
    3701  ctaccttctg ccagaggttc ccggaggagt agtgatcctt tgggggtgat
    3751  tcatagctag gaaaggtcgg agagttggga ggaggccaac tgggggaggt
    3801  gctaggagca ccagatgcag cagagcaaaa atccgggttt catcgcctgg
    3851  tgcgggcgct caatgctgct aacacgttcc tgaaggaaga aaggtttcgg
    3901  tcgatggaga ccttaacccg ccc