Sequence of DPV Carnation mottle virus

Carnation mottle virus CP gene for Coat protein, genomic RNA, isolate Solan

ACC No: AJ844549

Dated: 2004-10-05 | Length: 1047 | CRC: 844924926

                !!NA_SEQUENCE 1.0
ID   AJ844549   standard; genomic RNA; VRL; 1047 BP.
XX
AC   AJ844549;
XX
SV   AJ844549.1
XX
DT   05-OCT-2004 (Rel. 81, Created)
DT   05-OCT-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Carnation mottle virus CP gene for Coat protein, genomic RNA, isolate Solan
XX
KW   Coat protein; CP gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1047
RA   Raikhy G.;
RT   ;
RL   Submitted (03-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan
RL   Bioresource Tech., P.O. Box 6, Palampur, Himachal Pradesh - 176061, INDIA.
XX
RN   [2]
RA   Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.;
RT   "Variability studies of different Carnation mottle virus isolates infecting
RT   carnations in India";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1047
FT                   /country="India:Northern Himalayan Region, Solan"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT                   /clone="391"
FT                   /isolate="Solan"
FT                   /specific_host="Dianthus caryophyllus"
FT   CDS             1. .1047
FT                   /gene="CP"
FT                   /product="Coat protein"
FT                   /function="Coat protein"
FT                   /protein_id="CAH59633.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLVGPGISGDVDYESARPIAICELVTQMEGQILKITKTTAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1047 BP; 301 A; 251 C; 284 G; 211 T; 0 other;

AJ844549  Length: 1047  October 12, 2004 08:59  Type: N  Check: 6785  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaaacatt
      51  ggcgcagaag ggggacaagt tagccgtgaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgctggatac
     151  actccagcga tcctagcctt cacaccccga cgaccacgga tgacgaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaacta ctaagcaccg tcaaaggtac cacgggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtctt
     351  cccacaactc tcgctgctgg cgacgaactt caacaagtac cgcattactg
     401  cgctcactgt gaagtactca cccgcgtgca gcttcgagac caatgggagg
     451  gtggctctgg gattcaacga tgacgcttcg gacacaccgc caaccaccaa
     501  ggttggattt tacgatctgg gcaaacatgt ggaaactgct gcacagacag
     551  ctaaggatct agtgatacca gtagacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttggacgaa tagtcttgtc
     651  aacatacggg tttgacaagg ctgacactgt ggtgggcgaa ttgttcatac
     701  agtacacgat tgtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  taatggcaac gagctacagc taagagtggt agccgctggg aaatggtgca
     851  ttatagtgcg gggtacggtt gagggaggct tcaccaaacc cacacttgtt
     901  ggaccgggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgaa ttggtgacac aaatggaggg ccagatattg aaaatcacca
    1001  agaccacagc agaacaacca ctccaatggg ttgtttatag gatgtga