Sequence of DPV Carnation mottle virus

Carnation mottle virus CP gene for Coat protein, genomic RNA

ACC No: AJ844552

Dated: 2004-10-05 | Length: 1047 | CRC: 722271398

                !!NA_SEQUENCE 1.0
ID   AJ844552   standard; genomic RNA; VRL; 1047 BP.
XX
AC   AJ844552;
XX
SV   AJ844552.1
XX
DT   05-OCT-2004 (Rel. 81, Created)
DT   05-OCT-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Carnation mottle virus CP gene for Coat protein, genomic RNA
XX
KW   Coat protein; CP gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1047
RA   Raikhy G.;
RT   ;
RL   Submitted (04-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan
RL   Bioresource Tech., PO Box # 6, Palampur, Distt. Kangra, Himachal Pradesh
RL   -176 061, INDIA.
XX
RN   [2]
RA   Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.;
RT   "Variability studies of different Carnation mottle virus isolates infecting
RT   carnations in India";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1047
FT                   /country="India:Northern Himalayan Region"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT                   /clone="390"
FT                   /specific_host="Dianthus caryophyllus"
FT   CDS             1. .1047
FT                   /gene="CP"
FT                   /product="Coat protein"
FT                   /function="Expression of coat protein"
FT                   /protein_id="CAH59636.1"
FT                   /translation="MEDKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASSSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRKTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPCF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPAGSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKAAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1047 BP; 299 A; 253 C; 282 G; 213 T; 0 other;

AJ844552  Length: 1047  October 12, 2004 08:59  Type: N  Check: 8257  ..

       1  atggaagata aaggagaaaa gatcgcgatg aatcccactg tgcaaacatt
      51  ggcgcagaag ggggacaagt tagccgtgaa gttggtgaca aggggttggg
     101  cctcttcgag tacgaaccag aagaggagag ctgaaatgct cgctggatac
     151  actccggcga tcctagcctt cacaccccga cgaccacgga agacgaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaacta ttaagcaccg tcaaaggtac caccggtgtt
     301  atcccatgct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtctt
     351  ccctcaactc tcgctgctgg cgacgaactt caacaagtac cgcattactg
     401  cgctcactgt gaagtactca cccgcgggca gcttcgagac caatgggagg
     451  gtggctctag gattcaacga tgacgcttcg gatacaccac caaccaccaa
     501  ggttggattt tacgatctgg gcaaacatgt ggaaactgct gcacagacag
     551  ccaaagatct agtgatacca gtagacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttggacgga tagtcttgtc
     651  aacatacggg tttgacaagg ctgacactgt ggtgggcgaa ttattcatac
     701  agtacacgat cgtgctgagt gacccaacca aggcggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  taatggcaac gagctacaac taagagtggt agccgctggg aaatggtgca
     851  ttatagtgcg gggtacggtt gagggcggct tcaccaaacc tacacttatt
     901  gggccaggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgag ttggtgacac aaatggaggg ccaaatattg aaaatcacca
    1001  agacctcagc agaacaacca ctccaatggg ttgtttatag gatgtga