Sequence of DPV Carnation mottle virus

Carnation mottle virus p9 gene for Movement protein p9, genomic RNA, clone 393

ACC No: AJ844585

Dated: 2004-10-05 | Length: 255 | CRC: -32484096

                !!NA_SEQUENCE 1.0
ID   AJ844585   standard; genomic RNA; VRL; 255 BP.
XX
AC   AJ844585;
XX
SV   AJ844585.1
XX
DT   05-OCT-2004 (Rel. 81, Created)
DT   05-OCT-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Carnation mottle virus p9 gene for Movement protein p9, genomic RNA, clone
DE   393
XX
KW   Movement protein p9; p9 gene.
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-255
RA   Raikhy G.;
RT   ;
RL   Submitted (04-OCT-2004) to the EMBL/GenBank/DDBJ databases.
RL   Raikhy G., Plant Virus Lab, Floriculture Division, Institute of Himalayan
RL   Bioresource Tech., P.O. Box 6, Palampur, Himachal Pradesh - 176061, INDIA.
XX
RN   [2]
RA   Raikhy G., Hallan V., Kulshrestha S., Sandhu G., Verma R.R., Zaidi A.A.;
RT   "Variability studies of movement protein and coat protein genes of
RT   different Carnation mottle virus Indian strains";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .255
FT                   /country="India:Northern Himalayan Region, Palampur"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Carnation mottle virus"
FT                   /clone="393"
FT                   /isolate="Palampur"
FT                   /lab_host="Dianthus barbatus"
FT                   /specific_host="Dianthus caryophyllus"
FT   CDS             1. .255
FT                   /gene="p9"
FT                   /product="Movement protein p9"
FT                   /protein_id="CAH59641.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLKCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKQQHISISTPNGK"
XX
SQ   Sequence 255 BP; 79 A; 51 C; 45 G; 80 T; 0 other;

AJ844585  Length: 255  October 12, 2004 08:59  Type: N  Check: 7820  ..

       1  atgccatccg taaacctgca tctgatagta ctaacggggg taattgggtt
      51  aatgttgctg ataagattga agtgcacatt cacttcaact tttagtttgc
     101  ccccactggt aactttaaat cagattatag cgttgtcatt ttgtggtctt
     151  ctattaaaca gcatctctcg ggcagaaaga gcttgctatt acaactactc
     201  tgttgatagt tccaaacaac aacacatttc tataagtaca ccaaatggaa
     251  aataa