Sequence of DPV Rice yellow mottle virus
Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Ma105
ACC No: AJ885135
Dated: 2005-06-23 | Length: 720 | CRC: 1302157760
!!NA_SEQUENCE 1.0 ID AJ885135 standard; mRNA; VRL; 720 BP. XX AC AJ885135; XX SV AJ885135.1 XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Ma105 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the EMBL/GenBank/DDBJ databases. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 0:0-0(0). XX RN [3] RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX FH Key Location/Qualifiers FH FT source 1. .720 FT /country="Mali" FT /db_xref="taxon:31744" FT /mol_type="mRNA" FT /virion FT /organism="Rice yellow mottle virus" FT /isolate="Ma105" FT CDS 1. .720 FT /evidence=EXPERIMENTAL FT /note="ORF4" FT /product="coat protein" FT /protein_id="CAI59682.1" FT /translation="MARKGKKINSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNTWPLHSVEFLADFKRSATSADATTYDCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSAAAAGSIEMCFLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSKTDPNVVNTILPARLAVRSSIKPTVDDTPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 157 A; 197 C; 212 G; 154 T; 0 other; AJ885135 Length: 720 June 28, 2005 08:34 Type: N Check: 7332 .. 1 atggccagga agggcaagaa aatcaactcc aaccaggggc agcaaggaaa 51 gaagaagagc cggcgtccac gtgggcgttc ggcggagccc cagcttcaac 101 gggctccagt ggctcaggcc tcccggatat ctgggacggt tcctggtcca 151 ctatcttcta acacctggcc gctccactcc gtggaattcc tggcggattt 201 taagcggagt gccacctcag cagacgcgac gacatacgat tgtgtgccgt 251 tcaatctgcc tcgagtgtgg agtcttgcgc gttgttactc catgtggaag 301 ccaacacggt gggatgtcgt ttacctccct gaggtgagcg cggcggcagc 351 tggaagtatc gagatgtgtt ttctctacga ctatgctgac accatcccaa 401 gtgacacggg caagatgagc aggacggcgg gcttcgtcac ctccagcgtt 451 tggtacggcg cagagggctg ccacttactg agtggcggct cagcacgaaa 501 tgccgtggtc gcctcgatgg attgttcccg agtcggctgg aaacgtgtta 551 ctagttccat tcctagtaaa acggatccca acgtcgtaaa caccatactg 601 ccagctaggc tagctgtgcg gtcgtcgatc aaaccgacgg ttgatgatac 651 gccggggaaa ctctacgcta ttgtcagtat ggtcctgcgg gatccggttg 701 atccaacact caatacgtga