Sequence of DPV Rice yellow mottle virus
Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Tz15
ACC No: AJ885156
Dated: 2005-06-23 | Length: 720 | CRC: -226001916
!!NA_SEQUENCE 1.0 ID AJ885156 standard; mRNA; VRL; 720 BP. XX AC AJ885156; XX SV AJ885156.1 XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Tz15 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the EMBL/GenBank/DDBJ databases. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 0:0-0(0). XX RN [3] RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX FH Key Location/Qualifiers FH FT source 1. .720 FT /country="Tanzania" FT /db_xref="taxon:31744" FT /mol_type="mRNA" FT /virion FT /organism="Rice yellow mottle virus" FT /isolate="Tz15" FT CDS 1. .720 FT /evidence=EXPERIMENTAL FT /note="ORF4" FT /product="coat protein" FT /protein_id="CAI59703.1" FT /translation="MARKGKKISSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRVSG FT TVPGPLSSSSWPVHSVEFLMDFKRSATSAEATTFNCVPFNLPRVWSLARCYSLWKPTRW FT DVIYLPEVSAATAGSIEMCYLYDYADAIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT TARNAVVASMDCSRVGWRRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVDDVPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 154 A; 194 C; 216 G; 156 T; 0 other; AJ885156 Length: 720 June 28, 2005 08:34 Type: N Check: 7523 .. 1 atggccagga agggcaagaa aatcagctcc aaccagggcc agcaaggaaa 51 gaagaagagt cggcgtcccc gtgggcgttc ggcggagccc cagcttcaac 101 gggctccagt ggctcaggcc tcccgggtat ctgggacggt tcctggtcca 151 ctatcttcta gctcctggcc ggtccactcc gtggaattcc taatggattt 201 taagcggagt gccacatcag cagaagcgac gacattcaac tgtgtgccgt 251 tcaatctgcc tcgggtgtgg agtcttgcgc gttgttactc actgtggaag 301 ccaacacggt gggatgtcat ctacctccct gaggttagtg cggcgacagc 351 tggaagtatt gagatgtgct atctctacga ctacgctgac gccattccaa 401 gtgacacggg caagatgagc aggacggcgg gcttcgtcac ctctagcgtt 451 tggtacggcg ctgagggctg ccacttgttg agtggcggca cagcacgaaa 501 tgccgtggtc gcctcgatgg attgctctcg agtcggctgg agacgcgtta 551 ctagttcaat acctagtagc gtggatccca acgtcgtaaa caccatactg 601 ccagcaaggc tagctgtgcg gtcgtcgatc aaaccgacgg ttgatgatgt 651 gccggggaaa ctctacgcca tcgtcagtat ggtcctgcgg gatccggttg 701 atccaacact caatacgtga