Sequence of DPV Rice yellow mottle virus
Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Tz22
ACC No: AJ885163
Dated: 2005-06-23 | Length: 720 | CRC: 1076119317
!!NA_SEQUENCE 1.0 ID AJ885163 standard; mRNA; VRL; 720 BP. XX AC AJ885163; XX SV AJ885163.1 XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate Tz22 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the EMBL/GenBank/DDBJ databases. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 0:0-0(0). XX RN [3] RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX FH Key Location/Qualifiers FH FT source 1. .720 FT /country="Tanzania" FT /db_xref="taxon:31744" FT /mol_type="mRNA" FT /virion FT /organism="Rice yellow mottle virus" FT /isolate="Tz22" FT CDS 1. .720 FT /evidence=EXPERIMENTAL FT /note="ORF4" FT /product="coat protein" FT /protein_id="CAI59710.1" FT /translation="MARKGKKINSNQNQQGKKGRRPRGRSAEPRLQRAPVAQASRISGM FT VPGPLSSNVWPVQRSVEFLMDFKRSATSADATIFNCVPFNLPRVWSLARCYSLWKPTRW FT DVVYLPEVSAATAGSIEMCYLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLTGG FT SARNAVVASMDCSRVDWKRVTSSIPSGVDPNVVNTILPARLAVRSSIKPAVDDAPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 153 A; 192 C; 211 G; 164 T; 0 other; AJ885163 Length: 720 June 28, 2005 08:34 Type: N Check: 1134 .. 1 atggccagga agggcaagaa aatcaactcc aaccaaaacc agcaaggcaa 51 gaagggccgg cgtccccgtg ggcgttcggc ggagccccgg cttcaacggg 101 ctccagtggc tcaggcctcc cggatatctg ggatggttcc tggtccacta 151 tcttctaatg tctggccggt tcaacgctcc gtggaattcc tgatggattt 201 taagcggagc gccacctcgg cagatgcgac catattcaac tgtgtgccgt 251 tcaatctgcc ccgagtgtgg agtcttgcac gttgttactc cttgtggaag 301 ccaacaaggt gggatgttgt ctacctccct gaggttagtg cagcgacggc 351 tggaagtatt gagatgtgct atctctacga ctatgccgat acaatcccaa 401 gtgacacggg taagatgagc aggacggcgg gcttcgtcac ctctagcgtc 451 tggtacggcg cggagggctg ccatttgtta actggtggct cagcacggaa 501 tgccgtggtc gcctcgatgg attgttcccg agtcgactgg aaacgcgtta 551 ctagttcaat tcctagtggc gtggatccca acgtcgtaaa caccatactg 601 ccagctaggc tagctgtgcg gtcgtcgatt aaaccggcgg ttgatgatgc 651 accaggcaag ctgtatgcca tcgtcagtat ggtcctgcgg gatccggttg 701 acccaacact caatacgtga