Sequence of DPV Rice yellow mottle virus
Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate To4
ACC No: AJ885167
Dated: 2005-06-23 | Length: 720 | CRC: 789466087
!!NA_SEQUENCE 1.0 ID AJ885167 standard; mRNA; VRL; 720 BP. XX AC AJ885167; XX SV AJ885167.1 XX DT 23-JUN-2005 (Rel. 84, Created) DT 23-JUN-2005 (Rel. 84, Last updated, Version 1) XX DE Rice yellow mottle virus mRNA for coat protein (ORF4 gene), isolate To4 XX KW coat protein; cp gene; ORF4. XX OS Rice yellow mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Sobemovirus. XX RN [1] RP 1-720 RA Fargette D.; RT ; RL Submitted (17-FEB-2005) to the EMBL/GenBank/DDBJ databases. RL Fargette D., Dgpc, Ird, BP64501, 34394 Montpellier cedex 5, FRANCE. XX RN [2] RA Traore O., Sorho F., Pinel A., Abubakar Z.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 0:0-0(0). XX RN [3] RA Traore O., Sorho F., Pinel A., Abubakar Z., Banwo O., Maley J., Hebrard E., RA Winter S., Sere Y., Konate G., Fargette D.; RT "Processes of diversification and dispersion of Rice yellow mottle virus RT inferred from large-scale and high resolution phylogeographic studies"; RL Mol. Ecol. 14(7):2097-2110(2005). XX FH Key Location/Qualifiers FH FT source 1. .720 FT /country="Togo" FT /db_xref="taxon:31744" FT /mol_type="mRNA" FT /virion FT /organism="Rice yellow mottle virus" FT /isolate="To4" FT CDS 1. .720 FT /evidence=EXPERIMENTAL FT /note="ORF4" FT /product="coat protein" FT /protein_id="CAI59714.1" FT /translation="MARKGKKTNSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT MVPGPLSSNTWPLHSVEFLADFKRSSTSADATTYNCVPFNLPRVWSLARCYSMWKPTRW FT DVVYLPEVSATVAGSIEMCFLYDYADTIPSDTGKMSRTAGFVTSSVWYGAEGCHLLSGG FT SARNAVVASMDCSRVGWKRVTSSIPSSVDPNVVNTILPARLAVRSSIKPTVDDTPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 157 A; 193 C; 211 G; 159 T; 0 other; AJ885167 Length: 720 June 28, 2005 08:34 Type: N Check: 9860 .. 1 atggccagga agggcaagaa aaccaactcc aaccaggggc agcaaggaaa 51 gaagaagagc cgacgcccgc gtgggcgttc ggcggagccc cagcttcaac 101 gggctccagt ggctcaggcc tcccggatat ctgggatggt tcctggtcca 151 ctatcctcta acacctggcc gctccactcc gttgagttcc ttgcggactt 201 caagcggagt tccacatcgg cggatgcgac gacatacaat tgtgtgccgt 251 ttaatctgcc tcgggtgtgg agtcttgcac gttgttactc gatgtggaag 301 ccaacacggt gggatgttgt ctacctcccg gaggttagtg caacagttgc 351 tgggagtatc gagatgtgtt ttctctacga ctatgctgac acaatcccaa 401 gtgacacggg caagatgagc aggacggcgg gcttcgtcac ctccagcgtt 451 tggtacggcg cggagggctg ccacttatta agtggtggct cagcacgaaa 501 tgccgtggtc gcctcgatgg actgttctcg agtcggctgg aaacgcgtta 551 ctagttctat tcctagtagc gtggatccca acgtcgtaaa caccatactg 601 ccagcaaggc tagctgtgcg atcgtcgatc aaaccgacgg ttgacgatac 651 gccggggaaa ctctatgcta tcgttagtat ggtcctgcgg gacccggttg 701 atccaacact caatacgtga