Sequence of DPV Angelonia flower break virus

Angelonia flower mottle virus CP gene for coat protein, genomic RNA

ACC No: AM050058

Dated: 2006-11-17 | Length: 1056 | CRC: -969878299

                
ID   AM050058; SV 1; linear; genomic RNA; STD; VRL; 1056 BP.
XX
AC   AM050058;
XX
DT   01-OCT-2005 (Rel. 85, Created)
DT   17-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Angelonia flower mottle virus CP gene for coat protein, genomic RNA
XX
KW   coat protein; CP gene.
XX
OS   Angelonia flower mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1056
RA   Winter S.;
RT   ;
RL   Submitted (16-JUL-2005) to the EMBL/GenBank/DDBJ databases.
RL   Winter S., Plant Virus Division, DSMZ, c/o BBA, Messeweg 11/12, 38104,
RL   GERMANY.
XX
RN   [2]
RA   Winter S., Hamacher A., Engelmann J., Lesemann D.E.;
RT   "Angelonia flower mottle, a new disease of Angelonia angustifolia caused by
RT   a hitherto unknown carmovirus";
RL   Plant Pathol. 55(6):820-820(2006).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1056
FT                   /organism="Angelonia flower mottle virus"
FT                   /specific_host="Angelonia sp."
FT                   /mol_type="genomic RNA"
FT                   /country="Germany"
FT                   /virion
FT                   /db_xref="taxon:336861"
FT   CDS             1. .1056
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q3LB12"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LB12"
FT                   /protein_id="CAJ18242.1"
FT                   /translation="MSNLRNDPRVAKLAAQGSAWAKRLMNNGWGGLRPNQKAAARQALG
FT                   ILPAPVATPVATTRLVNGNPTNQRRKRNQPGNLRTDTPVTSTEFFADVLLHTGEDANIR
FT                   SWVINPREVSLFPRLSIQSALYDKYRISSLRVRFASSCSFDVNGKIMLGFIGDSSDEVP
FT                   VTKIDVHSLTKTAECTAMQNIIFNVGGDNITRFLGDRASDDPKLVNFGRIVLCTYGFDS
FT                   NAPSIVGELSVEYTITLLNPSPVASLSQRWISGSSKGIGFVEYTQDVATKTYQFAFQTG
FT                   GRYCLIVATDKGVFGSPLVTGSVQTQSRVVTDGTATLMTVSVDMKAPNGTISWVPPTDQ
FT                   GALTEWIVTRV"
XX
SQ   Sequence 1056 BP; 256 A; 306 C; 255 G; 239 T; 0 other;

am050058 Length: 1056  17-NOV-2006  Type: N  Check: 6022  ..

       1  atgagcaatc tccgcaacga cccgcgagtc gcaaagcttg ctgcccaagg
      51  ctcagcctgg gccaaacgac tcatgaacaa tggttggggt gggcttcggc
     101  cgaatcagaa agctgcagca cggcaagcac tgggaatcct ccccgctcct
     151  gttgccactc ccgtggccac caccaggtta gtcaacggta accccaccaa
     201  ccagaggcgt aaacgcaatc agcctggcaa tctgcgtact gatacgccag
     251  tcaccagtac tgaattcttc gccgacgtac tgttacacac tggagaagac
     301  gcaaacatcc gctcttgggt catcaacccc cgagaggtca gcctcttccc
     351  tcggctctct atccaatccg cgctgtacga caagtaccgc atatcttctc
     401  tccgagttcg tttcgcttcc tcttgttcgt ttgatgtgaa cgggaagatc
     451  atgctcgggt tcattggaga ctcctctgat gaggtgcccg tcacaaagat
     501  cgacgttcac tccctcacta agacagcaga gtgtactgct atgcagaaca
     551  tcatttttaa cgtgggagga gacaacatca cccgctttct cggtgacaga
     601  gcaagcgacg acccgaagct tgtcaacttt ggccgcatcg tgctctgcac
     651  ttacggcttt gacagcaatg caccatccat tgtcggagag ttgtctgtcg
     701  agtacaccat caccctactc aatccatccc ctgttgctag tctgtctcaa
     751  aggtggatca gcggcagctc caaaggaata gggtttgtgg agtacacaca
     801  agatgtcgca acaaagactt accaattcgc cttccaaaca ggaggacggt
     851  attgtcttat tgtcgccacg gacaaagggg tctttggatc tcctcttgta
     901  acagggtcag tccaaacgca gtcacgtgtg gtgactgacg gaaccgccac
     951  actcatgacg gtgtccgtag atatgaaagc tcctaatggc accatcagtt
    1001  gggttccgcc aacagatcaa ggtgcactca ctgagtggat tgtcactcgg
    1051  gtataa