Sequence of DPV Pelargonium chlorotic ring pattern virus

Pelargonium chlorotic ring pattern virus isolate GR57, complete genome.

ACC No: AY038069

Dated: 2004-07-09 | Length: 3904 | CRC: 770644239

                !!NA_SEQUENCE 1.0
ID   AY038069   standard; genomic RNA; VRL; 3904 BP.
XX
AC   AY038069;
XX
SV   AY038069.2
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   09-JUL-2004 (Rel. 80, Last updated, Version 2)
XX
DE   Pelargonium chlorotic ring pattern virus isolate GR57, complete genome.
XX
KW   .
XX
OS   Pelargonium chlorotic ring pattern virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-3904
RA   Kinard G., Guaragna M.A., Jordan R.;
RT   "Characterization and genome organization of four unique viruses infecting
RT   geranium and their assignment to a new provisional genus in the
RT   Tombusviridae family (#VP64.13)";
RL   (in) Unknown A. (eds.);
RL   XITH INTERNATIONAL CONGRESS OF VIROLOGY:415-0;
RL   Unknown Publisher (1999)
XX
RN   [2]
RP   1-3904
RA   Kinard G., Jordan R.;
RT   "Genome organization of Pelargonium chlorotic ring pattern virus: further
RT   implications for tombusviridae taxonomy";
RL   Acta Hortic. 568:17-27(2002).
XX
RN   [3]
RP   1-3904
RA   Jordan R.;
RT   ;
RL   Submitted (05-JAN-2001) to the EMBL/GenBank/DDBJ databases.
RL   Floral & Nursery Plants Research Unit, USDA, ARS, US National Arboretum,
RL   10300 Baltimore Ave, Bldg 010A, Room 238, Beltsville, MD 20705, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-3904
RA   Jordan R.;
RT   ;
RL   Submitted (08-JUL-2004) to the EMBL/GenBank/DDBJ databases.
RL   Floral & Nursery Plants Research Unit, USDA, ARS, US National Arboretum,
RL   10300 Baltimore Ave, Bldg 010A, Room 238, Beltsville, MD 20705, USA
XX
CC   On Jul 8, 2004 this sequence version replaced gi:15010538.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3904
FT                   /db_xref="taxon:167021"
FT                   /mol_type="genomic RNA"
FT                   /virion
FT                   /organism="Pelargonium chlorotic ring pattern virus"
FT                   /isolate="GR57"
FT   5'UTR           1. .16
FT   gene            17. .2308
FT                   /gene="RdRp"
FT   CDS             17. .2308
FT                   /codon_start=1
FT                   /note="p87; putative readthrough protein of p27 ORF"
FT                   /transl_except=(pos:734. .736,aa:OTHER)
FT                   /gene="RdRp"
FT                   /product="87 kDa replicase protein"
FT                   /protein_id="AAT69549.1"
FT                   /translation="MFRSLVTAARVGGALAVFAKDLAVLPAEVGVFATRLIITRTIEVI
FT                   PEYLHMIAPGASRIPKSVLTGQAFTSYDVEYNGTSDLENSCEVATEDVIEVEGKTTKVV
FT                   KTRRARNKLQFSALLAIAAKNHFGGIVRPTRANELSVMKFLTSKCNDHKLTIAQTRSVC
FT                   CAAFPLVFSPDEGDKLIFATLNSEEAFERRQDYSEAQGVGNCWLNLLSNPCSRRRWRRV
FT                   VLRCFGMPVQEAFQFAKXGCLMQTCGVDTKVFRGEHHWVKEAHEASYIPPRRLFSISGL
FT                   GPTIDWGVHNCSYVNLRRGLMERVYFVERKGKLEPCPRPAEGEFARLFKKYGHRVVGLC
FT                   GSHSKISREEFVGSYQGRKRTIYTNAMTSLLDKPLELRDSFLSTFVKCEKLNFSKKPDP
FT                   APRVIQPRDPRYNVELGCYLKRFEHSAYRALDKLWGGPTVMKGYTVQEIGKIIESKWNE
FT                   YRRPVAIGFDMSRFDQHVSVDALKFEHKIYKRVFRGDQNLARLLDWQLENRGTAYAKDG
FT                   WLKYKVNGKRMSGDMNTALGNCILACVITKSIMDGAGVKCSLINNGDDCVVFCEDGQCR
FT                   AVEDSLTGGWLKFGFTCIAEKPVKVLEKVEFCQMQPVLTVGGYTMVRNPKISLSKDCHS
FT                   TTPFDSIKLAREWSYSVGLGGRSLTVGVPVVHDFYQCLERNGKQHNNERKMRLFYGDYY
FT                   GKWVAMHKGGNHFVTEEARHSFHLAFDISPDQQEAMEEFYQNKELCWEFSPFSKVHNDI
FT                   EWTLAHPVPI"
FT   CDS             17. .736
FT                   /codon_start=1
FT                   /note="p27; shares amino terminus with p87 ORF"
FT                   /gene="RdRp"
FT                   /product="27 kDa putative replicase protein"
FT                   /protein_id="AAT69550.1"
FT                   /translation="MFRSLVTAARVGGALAVFAKDLAVLPAEVGVFATRLIITRTIEVI
FT                   PEYLHMIAPGASRIPKSVLTGQAFTSYDVEYNGTSDLENSCEVATEDVIEVEGKTTKVV
FT                   KTRRARNKLQFSALLAIAAKNHFGGIVRPTRANELSVMKFLTSKCNDHKLTIAQTRSVC
FT                   CAAFPLVFSPDEGDKLIFATLNSEEAFERRQDYSEAQGVGNCWLNLLSNPCSRRRWRRV
FT                   VLRCFGMPVQEAFQFAK"
FT   gene            2278. .2611
FT                   /gene="p7-FS"
FT   CDS             join(2278. .2456,2458. .2611)
FT                   /codon_start=1
FT                   /note="p13; shares amino terminus with p7 movement protein
FT                   via a putative -1 frameshift; ribosomal slippage"
FT                   /gene="p7-FS"
FT                   /product="putative 13 kDa movement protein"
FT                   /protein_id="AAT69551.1"
FT                   /translation="MDPSPPSADITSTQQNQKRGKAKNRLDVAHSGVSKASNSDLVGAN
FT                   FITVAETVNFTVHLNFDWGLASPNLLLFITFNFFLVSVFSVGDRYSYYYQANSTADKFI
FT                   SVAVGK"
FT   gene            2278. .2463
FT                   /gene="p7"
FT   CDS             2278. .2463
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative 7 kDa movement protein"
FT                   /protein_id="AAT69552.1"
FT                   /translation="MDPSPPSADITSTQQNQKRGKAKNRLDVAHSGVSKASNSDLVGAN
FT                   FITVAETVNFTVHLNF"
FT   gene            2608. .3621
FT                   /gene="CP"
FT   CDS             2608. .3621
FT                   /codon_start=1
FT                   /db_xref="GOA:Q911J4"
FT                   /db_xref="UniProt/TrEMBL:Q911J4"
FT                   /gene="CP"
FT                   /product="putative coat protein"
FT                   /protein_id="AAK74064.1"
FT                   /translation="MTASDSPITSKFAAQGAQWAIKLQTKGWRNLSKAQKREARSHGIG
FT                   PSAPPPAIPKVNRVIMGNPNNSRRRGGGDGNAQKSMTITKQEFLGTIFSSDSITTYPID
FT                   PRNVKTFPQISALALGYNKYKITSLQLRYSTRVTETEANVIMAFTTDSGDLPPRSKVDM
FT                   YNIGTKFEVLASKPLVATIPVSKDTKYLRDKCSDDSKLVDCGALHFMVDGRHSGRLGEL
FT                   FLQVTIVLSEPTFSQQSTQILRGTTQTGPTLVEFSQSGKSSTYKFLAVGRYVFSAYGKV
FT                   LVKARQVGMDKAKQMHTSDDKSSNVIAEVEALEPGASIVLDYVEEEPPSFVCISRM"
FT   CDS             3242. .3412
FT                   /codon_start=1
FT                   /note="putative p6 nested within 37 kDa capsidprotein ORF"
FT                   /gene="CP"
FT                   /product="6 kDa unknown protein"
FT                   /protein_id="AAT69553.1"
FT                   /translation="MGGTPEDSENCSSRSPSCFPNPLSPNKALRFSGVRRKPAPLLWNF
FT                   PRVASPALTSS"
FT   3'UTR           3622. .3904
XX
SQ   Sequence 3904 BP; 1030 A; 900 C; 1055 G; 919 T; 0 other;

 AY038069  Length: 3904  July 13, 2004 08:23  Type: N  Check: 3783  ..

       1  aaaagtaact ctcacgatgt ttagatcact agttactgca gctcgagtag
      51  gcggagcact tgccgtgttt gcgaaggact tggcggtcct tccagcagaa
     101  gtgggggtgt ttgccactcg actcatcatc accagaacca tcgaagttat
     151  tccagagtac ttacatatga ttgcgccagg agcgtcgcga attcccaaat
     201  cagtccttac aggacaggcg ttcaccagtt acgatgtgga gtacaatggc
     251  acgagcgacc tcgaaaacag ttgcgaggtt gccactgaag acgtgattga
     301  ggtagagggc aagaccacca aggtcgtgaa gaccagaagg gcgcgaaaca
     351  agttgcaatt ctccgccctg ctggctatcg cggcaaagaa ccattttggt
     401  ggtattgtac gccccacccg agccaatgag ctgtctgtca tgaagttttt
     451  gacttctaag tgcaacgacc acaaactaac catcgctcag acccggtctg
     501  tttgttgcgc tgcatttcct ctcgttttct ctcctgacga aggcgataag
     551  ttgatctttg ccaccctcaa tagcgaggag gcattcgaga ggagacagga
     601  ctactcagag gcccaggggg taggcaactg ctggttgaac ttactatcga
     651  acccatgcag ccgtaggaga tggcgcaggg tagtgttgag atgctttggg
     701  atgcctgtcc aagaggcatt ccaatttgcg aaataggggt gcctcatgca
     751  gacctgtggt gtggacacta aagtgttcag gggtgaacac cactgggtaa
     801  aggaagcgca cgaggcatcc tatattcccc cgcgtagatt gtttagtata
     851  tcaggtttag gtcccaccat agactggggg gtccacaact gtagctatgt
     901  gaacctgcgc cgcgggttaa tggagcgagt ttactttgtg gaacgcaagg
     951  gtaagcttga gccatgcccc cgaccggcgg agggagagtt cgctagactt
    1001  ttcaagaagt atggccaccg tgtggtggga ttgtgtggaa gtcattccaa
    1051  gatctcccgc gaagaatttg tgggatcgta tcaaggcagg aagcgcacga
    1101  tctacactaa cgcgatgacc agccttcttg ataagcctct tgagctccgt
    1151  gattcgtttt tgagtacgtt tgtaaagtgt gagaagttga actttagcaa
    1201  gaagccagac ccagcgccta gagtcataca gcccagggat ccgcgttaca
    1251  acgttgaact gggatgttat ttgaagcggt ttgagcactc tgcgtatcgc
    1301  gcattggaca aattgtgggg gggacccacc gtgatgaaag gatacactgt
    1351  ccaggagatt ggtaaaatca ttgagagcaa gtggaatgag taccggaggc
    1401  ctgtggcgat cggtttcgac atgagtcgat tcgaccagca tgtttccgtg
    1451  gatgccttga agttcgagca caagatctac aaacgggttt ttaggggtga
    1501  ccagaatttg gctcgccttt tggattggca gctcgagaat cggggcacgg
    1551  cttacgcaaa ggacggatgg ctgaagtaca aagtgaatgg gaaacggatg
    1601  agtggagaca tgaacacggc cttagggaac tgcatcctgg cgtgtgtcat
    1651  aaccaagagc attatggatg gggctggagt gaagtgctct ctgatcaaca
    1701  atggggatga ttgtgtggtg ttctgtgaag atgggcaatg ccgcgctgtc
    1751  gaggatagct tgacaggggg gtggcttaag ttcggattta catgcattgc
    1801  cgagaaacct gtgaaagtgt tagagaaagt cgaattttgc caaatgcagc
    1851  ctgtgctcac ggtcggtggc tacaccatgg taaggaaccc gaagataagt
    1901  ttatcgaagg actgtcattc aactacaccg tttgacagca tcaagttggc
    1951  tcgtgagtgg agctattccg tcgggttggg tggccgtagc ttaacggtcg
    2001  gcgtcccagt tgtacatgat ttttaccaat gtttggaacg aaacgggaaa
    2051  caacacaaca atgaaaggaa aatgcgactt ttttatgggg attattatgg
    2101  aaagtgggtt gcaatgcaca aaggtggtaa tcactttgtg acggaggagg
    2151  ctagacacag cttccatctc gcctttgaca tcagccccga tcaacaggaa
    2201  gccatggaag agttctacca gaacaaggag ttgtgttggg agttctcccc
    2251  attcagtaaa gtgcataacg atattgaatg gaccctagcc cacccagtgc
    2301  cgatataaca tcaacgcagc aaaatcaaaa gagaggtaaa gccaagaata
    2351  gactagacgt tgcccacagt ggagtcagca aagcatctaa cagcgatctc
    2401  gttggtgcta atttcattac tgtggctgaa actgtcaact tcacggtgca
    2451  ccttaacttt tgattgggga ttggcatctc ctaatttgct gcttttcata
    2501  acgttcaatt tcttcttagt tagtgtgttt agtgttggcg atcgctattc
    2551  gtactactac caggcaaaca gtaccgcaga caagttcatc tccgtcgcag
    2601  taggaaaatg actgcctccg acagcccgat cacatcgaaa tttgcagccc
    2651  agggagccca gtgggcgatc aagcttcaaa cgaaagggtg gcgcaatctc
    2701  agcaaagccc agaagagaga agcgaggtcg cacggcattg ggccttcagc
    2751  tcccccaccc gccataccaa aagtcaacag ggttatcatg ggtaacccta
    2801  ataatagcag acggcgagga ggtggtgacg gtaatgctca gaagagcatg
    2851  acgatcacca aacaggagtt ccttgggacc atattcagct cggacagcat
    2901  tactacctat ccaattgatc cccgaaacgt caagaccttc ccccagatca
    2951  gcgccttagc tttgggttac aataagtaca agataacctc gctccagctc
    3001  cgatactcaa ctagggtcac tgaaaccgag gccaacgtta ttatggcttt
    3051  cacaacggat tctggtgacc ttcctccgag gagcaaggtg gacatgtaca
    3101  acattggcac gaagtttgag gtgctggcgt ctaagccact agtggccaca
    3151  atccccgtct ccaaagacac gaaatatctg agagacaagt gttccgacga
    3201  ttcaaagttg gtagactgtg gtgccctcca ctttatggtg gatgggaggc
    3251  actccggaag actcggagaa ttgttcctcc aggtcaccat cgtgctttcc
    3301  gaacccactt tctcccaaca aagcactcag attctccggg gtacgacgca
    3351  aaccggcccc actcttgtgg aattttccca gagtggcaag tccagcactt
    3401  acaagttcct agccgtcgga cgctatgtct ttagcgccta tggtaaggtc
    3451  ttggtcaagg ctaggcaggt cggcatggat aaggcaaaac agatgcacac
    3501  cagcgacgac aaaagcagca acgtcatagc cgaggtggaa gccttagagc
    3551  cgggcgccag tatagtatta gactatgtcg aggaggagcc tccttctttt
    3601  gtttgtattt cccgtatgta attatttgta tatgttatgt ataattataa
    3651  tcatgcaatg gcacatgtag ttcccctaac ctctcagtag gagtcaagcc
    3701  ctgatgcgcc aacatccaga agggggtaaa gctgagtcgg tgcaaggaac
    3751  cttgttagcc ctaagaaaaa cccaaaaaca gagtgcatag tttagctttt
    3801  gtgttgtagg agccagagac caaagatcca gacaactggt gagggcggtc
    3851  gatggtgcga agtaaattag aaaggggggc gtttacccac gtcctccctt
    3901  gccc