Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus isolate Malfa5, complete genome.

ACC No: AY122286

Dated: 2005-04-16 | Length: 4271 | CRC: 1702058945

                !!NA_SEQUENCE 1.0
ID   AY122286   standard; mRNA; VRL; 4271 BP.
XX
AC   AY122286;
XX
SV   AY122286.1
XX
DT   06-AUG-2002 (Rel. 72, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Melon necrotic spot virus isolate Malfa5, complete genome.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4271
RX   DOI; 10.1007/s00705-002-0927-y.
RX   MEDLINE; 22494360.
RX   PUBMED; 12607110.
RA   Diaz J.A., Bernal J.J., Moriones E., Aranda M.A.;
RT   "Nucleotide sequence and infectious transcripts from a full-length cDNA
RT   clone of the carmovirus Melon necrotic spot virus";
RL   Arch. Virol. 148(3):599-607(2003).
XX
RN   [2]
RP   1-4271
RA   Diaz J.A., Bernal J.J., Moriones E., Aranda M.A.;
RT   ;
RL   Submitted (14-JUN-2002) to the EMBL/GenBank/DDBJ databases.
RL   Laboratorio Virologia, Consejo Superior de Investigaciones Cientificas,
RL   Estacion Experimental La Mayora, Algarrogo-Costa, Malaga 29750, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4271
FT                   /db_xref="taxon:11987"
FT                   /mol_type="mRNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="Malfa5"
FT   CDS             85. .2460
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8JMI2"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q8JMI2"
FT                   /transl_except=(pos:889. .891,aa:OTHER)
FT                   /product="p89"
FT                   /protein_id="AAM83188.1"
FT                   /translation="MDTGLKVLVNGGLATSSVFRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCNKIVKVASIIGIGYLGLRVGAAWCRRSPSVANSIISYGEEVVEQVKVDIDR
FT                   DAEEESDTGEEIVVGSIGIGIHTNINPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLIERVFFVEND
FT                   KKDLEPAPRPISGAFDRLTWFRRKLHNIVGTHSSISPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRRDAYLKTFVKAEKINTTKKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSTDALKWEHNVY
FT                   LDAFCHDSYLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEIFEQIE
FT                   FCQMRPVFDGEKYVMVRNPLVSLSKDSYSVGPWNGINHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSINSSSILRDVSFASGFRELARLGNRKSSAISENARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIDWGFVPQGNPRIQPISWTLNEL"
FT   CDS             85. .891
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q8JMI1"
FT                   /product="p29"
FT                   /protein_id="AAM83189.1"
FT                   /translation="MDTGLKVLVNGGLATSSVFRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCNKIVKVASIIGIGYLGLRVGAAWCRRSPSVANSIISYGEEVVEQVKVDIDR
FT                   DAEEESDTGEEIVVGSIGIGIHTNINPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLSHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2439. .2636
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8JMI0"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q8JMI0"
FT                   /product="p7A"
FT                   /protein_id="AAM83190.1"
FT                   /translation="MDPQRTVEQTKPRGRSKDRDDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2640. .2825
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProt/TrEMBL:Q8JMH9"
FT                   /product="p7B"
FT                   /protein_id="AAM83191.1"
FT                   /translation="MACYHCDSSPGDYSGALLILFISFVLFCITSLSPQGNTYVHHFDN
FT                   SSIKTQYVGISTNGDG"
FT   CDS             2812. .3984
FT                   /codon_start=1
FT                   /db_xref="GOA:Q8JMH8"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q8JMH8"
FT                   /product="coat protein p42"
FT                   /protein_id="AAM83192.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLADPKLVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGARPGTISAPVAISRRVAGMKPRFVRSEGSVKIVHREFV
FT                   ASVLPSNDLTVNNGDVNVGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRITYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSSPWAENVLVVPCDNIWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGDGVTAHGDLYVEYAVEFKDPQPIAGIVCMFDRSVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKPVGNSLNVT
FT                   SSGASALTFTLNSTGIPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 4271 BP; 1067 A; 886 C; 1062 G; 1256 T; 0 other;

 AY122286  Length: 4271  April 19, 2005 08:53  Type: N  Check: 4182  ..

       1  ggatatctct agccggatcc ccgactctct tgtttctgtg agattgttcg
      51  cgtgcctgtt tattttcttt ggcataggtt agcaatggat actggattga
     101  aagttcttgt taatggaggt ttagccacct cgtctgtttt tcggaaagtg
     151  agtgctgtga gttcattgga ttcgtccctc ccctcatcgt caatactgtc
     201  agccattcat gggtcttgga ctagtgctat cagccacgat tgcaataaga
     251  ttgttaaggt tgcttctatt attggtatcg gctacctcgg gttgcgcgtt
     301  ggtgccgctt ggtgtcgtcg ctcccccagt gttgccaatt ccattatatc
     351  atatggggaa gaagtggttg agcaagtaaa ggttgacatt gatagggatg
     401  ctgaggaaga gtccgatact ggtgaggaaa ttgtggttgg ttcgatcggc
     451  attggaatac ataccaatat caacccagag gttcgagcta agcgaaggca
     501  tagatcaagg ccgttcatta agaagatcgt gaatctgacc aaaaatcatt
     551  ttggagggtg ccctgattct agcaaatcga acgttatggc tgttagcaag
     601  tttgtttatg agcaatgtaa gcagcacaat tgtcttccac atcaaacgag
     651  attgatcatg agtatagcag ttccattggt attgagtccc gatatgtatg
     701  atatttctag caaggctctg ttgaatagcg agatattgac agagaacaga
     751  gctacgctgg accgcctcaa aactctcgat gggtggctgt cacatttggt
     801  gtgccatccc ttaagcgcta aggcttggag gcgggctatt gacaacttgt
     851  gtggtcttcc ggactggaag gctttcaagt tggtcaacta ggggtgccta
     901  gaggaactcg ctgggttctg tacttcggta cggaggggga cgcacccaga
     951  catgaccgag tttcctcagg atcgtcccat caaaacacgc aaactgtatt
    1001  gtctaggggg agttggaact agcgtgaagt tcaacgtgca taataactct
    1051  cttgccaacc ttcggcgcgg tctcatagaa cgcgttttct ttgttgaaaa
    1101  tgataagaag gaccttgagc ctgcccctag accaattagt ggtgcttttg
    1151  atcgcttgac ctggtttcgc agaaagctac ataatattgt gggtactcat
    1201  tccagtatta gtcctggtca attcttggac ttttatactg gcaggaggcg
    1251  cactatatat gagggcgctg tcaaatcgtt ggaggggttg agtgttcaac
    1301  gaagagatgc ttatttgaaa acatttgtca aagcggagaa gattaacacc
    1351  actaagaaac ctgacccagc tccgcgggtc atacaaccga ggaatgtacg
    1401  ttataatgtt gaagttggtc ggtatctacg taggtttgag cattacctct
    1451  atagaggaat tgacgaaatt tggaatgggc ccactattat aaagggatac
    1501  actgtcgaac agattggtaa gatagcccgt gacgcatggg attcattcgt
    1551  gagtccggtt gctattggat ttgatatgaa acggttcgat cagcatgtat
    1601  ccaccgacgc tcttaaatgg gaacataatg tttatcttga tgccttttgc
    1651  catgattcgt acttagctga gttattagaa tggcaattgg tcaataaggg
    1701  tgttgggtac gccagtgatg gaatgatcaa atataaggtt gacgggtgtc
    1751  gtatgagtgg tgatatgaat acagctatgg gtaattgtct gattgcttgt
    1801  gctatcacac atgatttctt tcgtagtcgt ggtatcaggg cgcgtttgat
    1851  gaacaatggt gatgattgcg ttgtaatatg tgaaaaggaa tgtgccgcgg
    1901  tggtcaaagc cgacatggta aggcactgga gacaattcgg gtttcagtgt
    1951  gaactcgagt gcgacgcaga aatctttgaa cagattgaat tttgtcagat
    2001  gcgacctgtg ttcgatggtg agaagtatgt gatggtacgg aatccgttag
    2051  ttagcctatc aaaagactcc tactcagtcg gtccctggaa cggaatcaac
    2101  catgcacgca agtgggttaa tgctgttggc ttgtgtggct tatccctcac
    2151  tggtggaata cctgttgtcc agagttatta taatatgatg atccgaaaca
    2201  cccagtccat taacagctct agcatacttc gtgatgttag ctttgctagt
    2251  ggatttcggg agttggctcg gttgggcaat aggaaaagta gtgccatttc
    2301  tgaaaacgcc cgttttagct tttatctcgc gtttggcatt actccagatt
    2351  tacaacgtgc catggaaagt gactatgatg ctcataccat tgactggggt
    2401  ttcgtgcccc agggaaatcc tagaatacag ccaatctcat ggaccctcaa
    2451  cgaactgtag aacaaactaa acctcgggga agaagtaaag atcgtgatga
    2501  tagtggggga aaacagaaga attcaatggg gcgaaagata gccaatgatg
    2551  ctatctctga atcgaagcag ggagttatgg gggcgagcac atatattgcc
    2601  gacaaaatta aagttaccat aaactttaat ttttaatata tggcttgtta
    2651  ccactgtgac tccagccccg gggattactc tggagcattg cttatactat
    2701  ttatctcatt cgtcttattc tgcattacct cgcttagccc gcaaggaaat
    2751  acttacgttc atcacttcga taattcttcc attaaaacac aatacgttgg
    2801  catctctacc aatggcgatg gttaaacgca ttaacaattt accaacagtg
    2851  aagcttgcta aacaggccct acctctctta gctgatccaa aattagtgaa
    2901  caaagctatt gatgtggttc ctttggtagt ccaaggtggt cagaaattgt
    2951  ctaaagctgc caagcggttg cttggtgctt acggaggcaa catttcttac
    3001  actgagggcg ccagacccgg taccatttcc gcccccgtcg ccattagtcg
    3051  ccgagtggcg ggcatgaagc ccaggtttgt tagatctgaa ggatctgtga
    3101  agatagttca tagggaattt gttgcttctg ttcttccgtc taatgacctc
    3151  actgttaata atggtgacgt caatgttggg aagtataggg tcaatcctag
    3201  taataatgct ctgttcacat ggcttcaggg acaagcgcaa ttgtatgata
    3251  tgtacagatt cacccgctta cgaatcacct atataccaac caccggttct
    3301  acttccacag gccgagtctc tatcctctgg gatagagatt ctcaggaccc
    3351  gcttccaatt gatcgtgcgg ccattagctc ttatgctcat tatgccgatt
    3401  cgtcaccctg ggctgagaat gtcctggtgg tgccgtgcga caatatatgg
    3451  aggtacatga atgataccaa tgctgtagac cgaaagttgg ttgattttgg
    3501  gcaatttctc tttgcgactt attctggtga tggtgtcact gcccatggtg
    3551  atctctatgt cgaatacgct gtcgagttta aagacccaca gccaatagcc
    3601  gggatagttt gtatgtttga ccgttcggtg tccttctctg aagtcggatc
    3651  caccatcaag ggggtgaatt atattgctga tcgcgacgtg ataactactg
    3701  ggggcaatat tggtgttaac atcaatattc ccgggaccta tctcgttacg
    3751  attgtattga atgccacctc gattggttct ctcaccttca ctggaaattc
    3801  taaacctgta ggcaacagtc ttaacgtcac tagtagcgga gcgtctgctt
    3851  tgaccttcac tctcaattcc accggcattc ccaacagtag taactcatca
    3901  ttctcagttg gtactgtcgt ggctttgacg agggttcgca tgacgatcac
    3951  tcggtgttct cccgaaactg cctacctcgc ctaattataa atctctttgt
    4001  atactctcca agtttgttcc tttttattcc tacttgttct cagccagatc
    4051  tctgttctgg tgtcttatag atttccctgt tgtgtgtagt gcggtctggc
    4101  taaccgtaac ggcgtatcgg caaggatttt cgatgattag gttccaggat
    4151  gtacgacata gctgaagata gatggagttt gaaggatcac cgctagcaaa
    4201  atacactctg tgtggggcgt gctggtggat agtcatgtaa gtttgagatg
    4251  ggttttcggc ccatcccgcc c