Sequence of DPV Turnip crinkle virus

Turnip crinkle virus isolate UK, complete genome.

ACC No: AY312063

Dated: 2003-07-01 | Length: 4053 | CRC: -1980710673

                !!NA_SEQUENCE 1.0
ID   AY312063   standard; RNA; VRL; 4053 BP.
XX
AC   AY312063;
XX
SV   AY312063.1
XX
DT   01-JUL-2003 (Rel. 76, Created)
DT   01-JUL-2003 (Rel. 76, Last updated, Version 1)
XX
DE   Turnip crinkle virus isolate UK, complete genome.
XX
KW   .
XX
OS   Turnip crinkle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4053
RA   Ryabov E.V.;
RT   ;
RL   Submitted (03-JUN-2003) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, Horticulture Research International, East Malling, West
RL   Malling, Kent ME19 6BJ, United Kingdom
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4053
FT                   /db_xref="taxon:11988"
FT                   /mol_type="genomic RNA"
FT                   /note="infectious clone"
FT                   /organism="Turnip crinkle virus"
FT                   /isolate="UK"
FT   CDS             63. .2390
FT                   /codon_start=1
FT                   /note="RNA replicase; translated by read-through of stop
FT                   codon"
FT                   /transl_except=(pos:813. .815,aa:OTHER)
FT                   /product="P88 protein"
FT                   /protein_id="AAP78486.1"
FT                   /translation="MPLLHTLNTALAVGLLGARYYPEVQTFLGLPDYVGHMKNVVQSVF
FT                   QGSGLVVVSSSTVGVRGTYSNRGQIGSSLGCILAVPDSGADIEIDLDRLVGTEEEATSC
FT                   LVEAVGSTADVPRRRVRQKGRFAMHAVNAAKLHFCGVPKPTEANRLAVSKWLVQYCKER
FT                   HVVDSHIRTIVNTALPRVFTPDAEDIQVVLDLHSVRAHNHRNALAEAGKVRKWWVNLAM
FT                   HPMTGRSWSRAWRRLCRLPDDQAISFVRXGCLRELVGRETQISRGENPAMRVFPLANPP
FT                   KVRRIFHICGMGNGLDFGVHNNSLNNLRRGLMERVFYVEDAQKQLKPAPQPIPGIFGKL
FT                   SGIRKRLVRLAGNHTPVPREKYPSFYKGRRATIYQKALDSLHDRPVSRKDAELKTFVKA
FT                   EKINFTAKKDPAPRVIQPRDPRYNIEVGKYLKPYEHHLYRAIDAMWGGPTVLKGYDVGE
FT                   LGNIMSNTWDKFRKTCAIGFDMKRFDQHVSVDALRWEHSVYNAGFNCPELAQLLTWQLT
FT                   NKGVGRASDGFIKYQVDGCRMSGDVNTALGNCLLACSITKYLMKGIKCKLINNGDDCVL
FT                   FFEAEEVDRVRERLHHWIDFGFQCIAEEPQYELEKVEFCQMSPIFDGEGWVMVRNPRVS
FT                   LSKDSYSTTQWANEKDAARWLAAIGECGLAIAGGVPVLQSYYSCLKRNFGPLAGDYKKK
FT                   MQDVSFDSGFYRLSKNGMRGSKNVSQDARFSFYRGFGYTPDEQEALEEYYDNLELLCEW
FT                   DPTGYKEELSDRWILNEFPTTL"
FT   CDS             63. .815
FT                   /codon_start=1
FT                   /product="P28 protein"
FT                   /protein_id="AAP78490.1"
FT                   /translation="MPLLHTLNTALAVGLLGARYYPEVQTFLGLPDYVGHMKNVVQSVF
FT                   QGSGLVVVSSSTVGVRGTYSNRGQIGSSLGCILAVPDSGADIEIDLDRLVGTEEEATSC
FT                   LVEAVGSTADVPRRRVRQKGRFAMHAVNAAKLHFCGVPKPTEANRLAVSKWLVQYCKER
FT                   HVVDSHIRTIVNTALPRVFTPDAEDIQVVLDLHSVRAHNHRNALAEAGKVRKWWVNLAM
FT                   HPMTGRSWSRAWRRLCRLPDDQAISFVR"
FT   CDS             2357. .2575
FT                   /codon_start=1
FT                   /product="P8 protein"
FT                   /protein_id="AAP78487.1"
FT                   /translation="MDPERIPYNSLSDSDAPGKRKKGGEKSAKKRLVASHAASSALNKK
FT                   RDEGSASHGGTWVIVADKVEVSINFNF"
FT   CDS             2496. .2753
FT                   /codon_start=1
FT                   /product="P9 protein"
FT                   /protein_id="AAP78488.1"
FT                   /translation="MKVLLATGVLGLLLLIKWKSQSTSTSNQVCQCPTSPWVIYAFYNS
FT                   LSLVLLLCHLIPEIKPIHTSYNTHDSSKQQHISINTGNGK"
FT   CDS             2743. .3798
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AAP78489.1"
FT                   /translation="MENDPRVRKFASEGAQWAIKWQKKGWSSLTSRQKQTARAAMGIKL
FT                   SPVAQPVQKVTRLSAPVALAYREVSTQPRVSTARDGITRSGSELITTLKKNTDTEPKYT
FT                   TAVLNPSEPGTFNQLIKEAAQYEKYRFTSLRFRYSPMSPSTTGGKVALAFDRDAAKPPP
FT                   NDLASLYNIEGCVSSVPWTGFILTVPTDSTDRFVADGISDPKLVNFGKLIMATYGQGAN
FT                   DAAQLGEVRVEYTVQLKNRTGSTSDAQIGDFAGVKDGPRLVSWSKTKGTAGWEHDCHFL
FT                   GTGNFSLTLFYEKAPVSGLENADASDFSVLGEAAAGSVQWAGVKVAERGQSVKMVTTEE
FT                   QPRGKWQALRI"
XX
SQ   Sequence 4053 BP; 1091 A; 981 C; 1106 G; 875 T; 0 other;

  AY312063  Length: 4053  July 8, 2003 08:46  Type: N  Check: 6713  ..

       1  gtaatctgca aatccctggc acccgcctaa aattgccctc atcaaccttc
      51  tctcttttca cgatgcctct cctacataca ctcaacacag cgctcgcagt
     101  gggactccta ggagccaggt actaccctga ggtgcaaacc ttcttggggc
     151  tacctgacta cgtgggtcac atgaagaatg tagtacaatc tgttttccag
     201  ggatctgggc tagtagtagt gtcctccagc acagtcggtg ttagggggac
     251  gtatagtaat agaggtcaga taggtagtag tctcgggtgt atactagccg
     301  ttccggatag cggggcggac atagaaatag acttagatag gttggtagga
     351  acggaagagg aagccacgtc ctgtctggtg gaggcggtag gtagtaccgc
     401  agatgtcccc aggaggagag tccgtcaaaa ggggcggttt gccatgcatg
     451  ccgtcaacgc agccaagctg cacttttgtg gcgttccgaa acccactgaa
     501  gcgaatcgac tagcggtctc aaaatggctt gtccaatact gcaaagagag
     551  acatgtcgta gacagccaca tcagaacgat agtcaatacg gctcttccaa
     601  gagtgtttac gcctgacgcg gaagacattc aggttgtgct ggatttgcac
     651  agtgtcagag cacacaacca ccgcaacgcg ctagccgaag caggcaaagt
     701  gcggaagtgg tgggtcaacc tcgcgatgca tcccatgaca gggaggtcgt
     751  ggtctagggc ttggaggcga ttatgccgcc tgcctgacga ccaggcgatc
     801  tcttttgtcc gctaggggtg cttgcgggag ctggtcggga gggagactca
     851  aatctccagg ggtgaaaacc cggccatgcg cgtgttcccg ttagcaaatc
     901  ccccgaaggt tcgacgcatc ttccatatct gtggaatggg caatggttta
     951  gactttggag tccacaacaa ctcactcaac aatttgagaa gagggttaat
    1001  ggagagagtc ttttacgttg aagatgcgca gaagcaattg aaaccagccc
    1051  cccaaccgat cccagggata ttcgggaagt tgagtgggat tcggaaacga
    1101  ttggtcaggt tggccggaaa tcatacccct gtacctcggg agaaataccc
    1151  gtcgttctac aagggcagga gggccaccat ttaccaaaaa gctctggatt
    1201  ctctacatga cagaccggtg tcccggaagg acgctgaact caaaacattc
    1251  gtgaaggcag aaaagatcaa tttcacggcg aagaaagacc cggctccacg
    1301  ggttatccag ccgagagacc cacgatataa cattgaggtt gggaaatact
    1351  tgaaaccgta cgagcaccat ttatatcggg caattgacgc tatgtggggt
    1401  gggcccactg tgctgaaagg atacgatgtg ggggagcttg gaaacattat
    1451  gagtaacacc tgggataaat tccggaaaac gtgtgcgata ggatttgaca
    1501  tgaagagatt cgaccaacac gtatccgtgg acgccctacg atgggaacac
    1551  agtgtataca acgcgggctt taactgtccc gagttggcac aactgctaac
    1601  ttggcagttg accaacaagg gagttggaag agcctccgat ggctttatca
    1651  aataccaagt tgatggttgt cgcatgtccg gggacgttaa cacagctttg
    1701  ggtaactgcc tcttggcttg ctctatcacc aagtacttaa tgaagggaat
    1751  caaatgcaaa ttaatcaaca atggagacga ttgtgtgctg ttcttcgaag
    1801  ctgaggaagt tgacagggtg cgcgaaaggc tgcaccattg gatcgacttt
    1851  gggtttcaat gcatagcaga agaaccacaa tacgagttgg agaaagttga
    1901  gttttgccag atgtccccta tttttgatgg tgaagggtgg gtcatggtta
    1951  gaaacccccg tgtgagcctt tccaaggata gctacagcac cacacaatgg
    2001  gcgaatgaga aagatgcagc cagatggttg gcggctatcg gagagtgtgg
    2051  cttggctatt gcaggtggcg taccagtgtt acaatcatat tattcttgcc
    2101  tgaagaggaa ttttggaccc ctggccgggg actacaagaa gaagatgcaa
    2151  gatgtttcct ttgatagtgg attctacagg ttatccaaaa acgggatgag
    2201  gggcagcaaa aatgtgtccc aagatgctag gttcagcttt taccgggggt
    2251  tcggctacac tccagacgag caggaagcgc ttgaggaata ctacgacaac
    2301  ctcgaactgc tctgtgagtg ggaccccacg ggatataaag aagaacttag
    2351  tgatagatgg atcctgaacg aattccctac aactctctaa gcgacagcga
    2401  cgcaccagga aaacggaaga aaggcggaga gaaaagtgcg aagaagagat
    2451  tggtagctag ccacgcggct agctctgctt taaacaagaa aagagatgaa
    2501  ggttctgcta gccacggggg tacttgggtt attgttgctg ataaagtgga
    2551  agtctcaatc aacttcaact tctaatcagg tttgccagtg cccgacgtcc
    2601  ccgtgggtaa tatatgcttt ctacaactct ctctcactgg tcctcctact
    2651  ctgtcatctg attcctgaaa tcaaaccgat tcacacatcc tacaacacac
    2701  acgactcatc gaagcagcaa cacataagca tcaacactgg aaatggaaaa
    2751  tgatcctaga gtccgaaagt tcgcatccga gggcgcccaa tgggcgataa
    2801  agtggcagaa gaagggctgg tcatccctaa ccagcagaca gaaacagacc
    2851  gcccgcgcag cgatggggat caagctctcc cctgtggcgc aacctgtgca
    2901  gaaagtgact cgactgagtg ctccggtggc tctcgcctac cgcgaggttt
    2951  ccacccagcc tcgggtttct actgccaggg acggcataac cagaagcggt
    3001  tctgaactga tcacaaccct gaagaagaac actgacactg aacctaagta
    3051  caccacagct gtgcttaacc caagcgaacc cggaacattc aaccaactca
    3101  tcaaggaggc ggcccagtat gaaaaatacc gattcacgtc actcagattt
    3151  aggtactctc ccatgagccc ttcaaccacc gggggcaagg tggctctggc
    3201  attcgaccga gacgctgcca aacctccgcc caacgacctc gcttccctct
    3251  acaacataga gggttgtgta tctagcgtgc cctggacagg gtttattttg
    3301  accgtcccaa cagattctac tgaccgcttt gtggcggatg gtatcagcga
    3351  tccaaagctt gtcaatttcg gcaagctcat catggccacc tatggccaag
    3401  gagccaatga tgccgcccaa ctcggtgaag tgcgagtcga gtacaccgtg
    3451  cagctcaaga acagaactgg ctcaaccagc gacgcccaga ttggggactt
    3501  cgcgggtgtt aaggacggac ccaggttggt ctcgtggtcc aagaccaagg
    3551  gaacagctgg gtgggagcac gattgtcatt ttctcggaac cggaaacttc
    3601  tcgttgacac tgttctacga gaaggcgccc gtttcggggc tagaaaacgc
    3651  agacgcctct gacttctcgg tcctgggaga agccgcagca ggtagtgtcc
    3701  aatgggctgg agtgaaggta gcagaaaggg gacaaagcgt gaaaatggtc
    3751  acaactgagg agcagccaag gggaaaatgg caagcactca ggatttagta
    3801  cggtaatagt gtagtcttct catcttagta gttagctctc tcttatatta
    3851  agaaaagaaa acaaaaaccc ccaggtcgct ttattttgac ctgtgttagg
    3901  gaccaaaaac ggtggcagca ctgtctagct gcgggcatta gactggaaaa
    3951  ctaatgctct ttgggtaacc actaaaatcc cgaaagggtg ggctgtggtg
    4001  accttccaag ccaaaagata gcctctcccc tcgcgcgggg ggggggcctg
    4051  ccc