Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus isolate MNSV264 29K protein, 89K protein, p7K protein, 14K protein, p7K protein, and 42K coat protein mRNAs, complete cds.

ACC No: AY330700

Dated: 2005-02-26 | Length: 4310 | CRC: -1409898783

                !!NA_SEQUENCE 1.0
ID   AY330700   standard; mRNA; VRL; 4310 BP.
XX
AC   AY330700;
XX
SV   AY330700.1
XX
DT   30-JAN-2004 (Rel. 78, Created)
DT   26-FEB-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Melon necrotic spot virus isolate MNSV264 29K protein, 89K protein, p7K
DE   protein, 14K protein, p7K protein, and 42K coat protein mRNAs, complete
DE   cds.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4310
RX   PUBMED; 15195949.
RA   Diaz J.A., Nieto C., Moriones E., Truniger V., Aranda M.A.;
RT   "Molecular characterization of a Melon necrotic spot virus strain that
RT   overcomes the resistance in melon and nonhost plants";
RL   Mol. Plant Microbe Interact. 17(6):668-675(2004).
XX
RN   [2]
RP   1-4310
RA   Diaz J.A., Nieto C., Moriones E., Truninger V., Aranda M.A.;
RT   ;
RL   Submitted (26-JUN-2003) to the EMBL/GenBank/DDBJ databases.
RL   Hortofruticultura Subtropical, Estacion Experimental La Mayora, Laboratorio
RL   de Virologia, Algarrobo-Costa, Malaga 29750, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4310
FT                   /db_xref="taxon:11987"
FT                   /mol_type="mRNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="MNSV264"
FT   CDS             88. .2463
FT                   /codon_start=1
FT                   /db_xref="GOA:Q6VRG4"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q6VRG4"
FT                   /note="putative RNA-dependent RNA polymerase; produced by a
FT                   readthrough of the amber codon; replicase"
FT                   /transl_except=(pos:892. .894,aa:OTHER)
FT                   /product="89K protein"
FT                   /protein_id="AAR01965.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVAAVVGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDINE
FT                   DAEEESDIGEEIVVGTIGIGIRTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLTHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLIERVFFVEND
FT                   KKELEPAPKPLSGAFDRLTWFRRKLHNIVGTHSSISPGKFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRRDAYLKTFVKAEKINTTKKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSSDALKWEHSVY
FT                   LDAFCHDSYLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEIFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGINHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSVNSSGILRDVSFASGFRELARLGNRKSGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNLRIQPISWTLNEL"
FT   CDS             88. .894
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q6VRG3"
FT                   /product="29K protein"
FT                   /protein_id="AAR01961.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVAAVVGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDINE
FT                   DAEEESDIGEEIVVGTIGIGIRTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLTHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2442. .2828
FT                   /codon_start=1
FT                   /db_xref="GOA:Q6VRG2"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProt/TrEMBL:Q6VRG2"
FT                   /note="produced by a readthrough of the amber codon"
FT                   /transl_except=(pos:2637. .2639,aa:OTHER)
FT                   /product="14K protein"
FT                   /protein_id="AAR01966.1"
FT                   /translation="MDSQRTVEQTNPRGRSKECGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNFXGMACCRCDSSPGDYSGALLILFISFVFFYITSLSPQGN
FT                   TYVHHFDNSSVKTQYVGISTNGDG"
FT   CDS             2442. .2639
FT                   /codon_start=1
FT                   /db_xref="GOA:Q6VRG1"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q6VRG1"
FT                   /product="p7A protein"
FT                   /protein_id="AAR01962.1"
FT                   /translation="MDSQRTVEQTNPRGRSKECGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2643. .2828
FT                   /codon_start=1
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProt/TrEMBL:Q6VRG0"
FT                   /product="p7B protein"
FT                   /protein_id="AAR01963.1"
FT                   /translation="MACCRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             2815. .3987
FT                   /codon_start=1
FT                   /db_xref="GOA:Q6VRF9"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q6VRF9"
FT                   /product="42K coat protein"
FT                   /protein_id="AAR01964.1"
FT                   /translation="MAMARRINNLPTVKLAKQALPLLANPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNVGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGDTAHGDLYVEYAVEFKDPQPIAGMVCMFDRSVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVS
FT                   SSGTSALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 4310 BP; 1068 A; 910 C; 1072 G; 1260 T; 0 other;

  AY330700  Length: 4310  March 8, 2005 08:33  Type: N  Check: 534  ..

       1  ggattactct agccggatcc ccgactctct tgtttctgta agttagttcg
      51  tgtattggtc atctgtcttg atcagtatag gttagcaatg gatactggtt
     101  tgaaatttct tgtttctggg gggttagcca cctcatctgt tatcaggaaa
     151  gtgagtgctg tgagttcatt ggattcgtcc cttccttcat catctatatt
     201  atctgccatc catgggtctt ggactagtgc tatcagccac gattgtagta
     251  aaattgccaa ggttgccgcc gtagttggta ttggttatct tggggtcagg
     301  attggtgccg cttggtgccg tcgtactccc gggataacga attccataat
     351  cacctatggg gaagaagtgg ttgagcaagt gaaggtagat attaatgaag
     401  atgctgaaga ggagtccgat attggtgagg aaattgtggt tggtacgata
     451  ggtattggta tacgcacaaa cgtcaaccct gaggttcgag ctaagcgcag
     501  acatagatcg aggccattca ttaagaagat tgtgaattta acgaagaatc
     551  acttcggtgg gtgccccgac tctagtaaat cgaatgtcat ggctgtaagc
     601  aaattcgttt atgaacaatg caaacaacac aattgtcttc cacatcaaac
     651  gagattgatc atgagtattg cagttccatt ggtgttaagt cccgatatgt
     701  acgacatttc cagcaaagct ctgttaaaca gcgagatatt gacagaaaac
     751  agagctacgc tggaccgcct taaaactctt gatgggtggc taacacattt
     801  ggtgtgccat ccccttagcg cgaaggcttg gaggcgggcc attgacaact
     851  tgtgtggtct tccagattgg aaggctttca agttggtcaa ctaggggtgc
     901  ctagaggaac tcgctgggtt ctgtacttcg gtacggagag ggacacaccc
     951  agacatgacc gagtttcctc aggatcgtcc cattaagaca cgcaaactgt
    1001  attgtttagg gggagttgga actagcgtga agttcaacgt gcacaataac
    1051  tctctagcta accttcggcg cggtctgatt gagcgcgttt tctttgttga
    1101  aaatgataag aaggaactag agcctgcccc taaacctctt agtggtgcgt
    1151  ttgatcgctt aacttggttt cgtcggaaac tccataatat tgtgggtact
    1201  cattccagta ttagtccagg taaattcctg gacttttata ctggcaggag
    1251  acgcacgatt tatgaaggtg ctgtgaaatc attggaaggg ttaagtgttc
    1301  aacgaaggga tgcctatctg aaaacgtttg ttaaagcgga gaagattaat
    1351  accactaaga agcctgaccc agctccgcgg gtcatacaac cgaggaacgt
    1401  aagatataat gttgaggttg gtcgttatct acgtaggttt gagcattacc
    1451  tctatcgagg aattgacgaa atctggaatg gccccaccat aattaaagga
    1501  tacactgtcg agcaaattgg gaaaatcgcc cgtgacgctt gggactcttt
    1551  cgttagtcca gtagcaatcg ggtttgacat gaaaaggttc gaccaacatg
    1601  tatcctccga tgctcttaaa tgggaacata gtgtttatct tgatgctttt
    1651  tgccacgact catatctcgc ggaattgtta gagtggcaat tagttaataa
    1701  gggtgttggg tatgctagtg atggaatgat taaatataag gttgatgggt
    1751  gccggatgag tggtgacatg aatacagcta tgggtaactg tttgattgcc
    1801  tgtgctatca cgcacgattt cttccgtagt cgtggtatca gggcgcgttt
    1851  gatgaacaat ggtgatgact gtgtcgtaat atgtgaaaaa gaatgtgccg
    1901  cggtggttaa agccgacatg gtaaggcact ggagacaatt cgggtttcaa
    1951  tgcgaacttg aatgcgacgc agaaatcttc gagcaaattg aattttgtca
    2001  aatgcggcct gtgtacgacg gggagaaata tgtgatggtg cggaatcctt
    2051  tggttagcct atctaaagat tcctactcag tcggcccttg gaatggaatc
    2101  aaccatgcac gcaagtgggt taatgcagtt ggcttgtgtg gcttatccct
    2151  cactggtgga attcctgttg tccaaagtta ttacaacatg atgatccgta
    2201  acacccagtc cgtaaacagt tctggtatac ttcgcgatgt cagctttgct
    2251  agtggatttc gggagttagc gcgattgggt aacaggaaaa gtggtgccat
    2301  ttctgaagac gcccgtttta gcttttatct cgcatttggc attactccag
    2351  atttacaacg tgccatggaa agtgactatg atgctcatac catagagtgg
    2401  ggttttgtgc cccagggaaa tcttagaata cagccaatct catggactct
    2451  caacgaactg tagaacaaac taatcctcgt ggaagaagta aagaatgtgg
    2501  tgacagcggg ggaaaacaga agaactcaat ggggcgaaag atagccaatg
    2551  atgctatctc cgaatcgaag caaggagtta tgggtgctag cacatacatt
    2601  gctgataaaa ttaaggtgac tattaacttt aatttttagg gtatggcttg
    2651  ttgccgttgc gactccagcc ccggggatta ctctggagca ttgcttatat
    2701  tatttatctc atttgttttc ttttatatta cctcgcttag cccgcaagga
    2751  aatacttacg ttcatcactt cgataattct tccgttaaaa cacaatacgt
    2801  tggcatctct acaaatggcg atggctagac gcattaacaa tttacccact
    2851  gtgaagcttg ctaagcaggc tctacccctg ctagcgaacc ctaaaattgt
    2901  gaataaagct atagatgtgg ttcctttggt cgtccaaggt ggtcagaaat
    2951  tgtccaaggc cgctaagcga ttgcttggtg cttatggagg caacatttcg
    3001  tatactgagg gtgccaaacc aggcgcaata tcagctcctg tcgctattag
    3051  tcggcgagtg gctggcatga agcctaggtt tgttcgatcg gaaggatctg
    3101  taaagatagt tcatagggag tttattgcct ctgttcttcc ttcgaatgat
    3151  ctcactgtta ataatggtga tgtcaacgtt ggcaagtata gagtcaatcc
    3201  cagtaataac gctttattca catggcttca gggacaagcg caactatatg
    3251  atatgtacag gtttactcgg ctccgtttca cctatattcc tactaccgga
    3301  tcgacttcca ccggtcgtgt ctctatcctt tgggatagag attctcagga
    3351  ccccctccct attgatcgtg ctgccattag ctcttatgct cattacgctg
    3401  attcagcgcc ttgggctgag aatgtcctag tggttccttg tgacaatacg
    3451  tggaggtaca tgaatgatac caatgccgtc gaccggaagt tggttgattt
    3501  tgggcagttc cttttcgcta cttattctgg tgctggtgac accgcccatg
    3551  gtgatcttta cgtcgagtat gctgttgaat tcaaggaccc ccagcctatc
    3601  gctgggatgg tatgtatgtt tgatcgctct gtctccttct ctgaagttgg
    3651  gtctactatt aagggagtca attatattgc tgatcgtgat gtgataacca
    3701  ctgggggcaa tattggtgtt aacatcaaca ttcccgggac ttatctcgtt
    3751  acgattgttc ttaatgccac atcgattggt tccctcacct tcactggcaa
    3801  ttctaaactt gtaggcaaca gtcttaatgt ttccagcagt ggtacatctg
    3851  ctcttacgtt cacccttaac tccactggtg tgcccaatag tagcaattct
    3901  tcgttctctg tgggtaccgt tgttgcattg actagggtgc gtatgacgat
    3951  cactcgctgc tctccagaaa ctgcctacct cgcctaaatc tcgccttagg
    4001  tttacggtta cccgagcttc gcctgaaacg gcgttcctct aattccttcc
    4051  tggttctttc cctccacggc tcgcgtgttc tgcggaactg catctgcttc
    4101  acttccttct ttttccctct gtggtggtac gaccaatggg tggctcccat
    4151  tgactgcgta ggacatggaa aaagattgag tggagtgcac gaagcgtcgc
    4201  aagatcgctg cctgacgagg tccagccaat caaataccaa acatctggtt
    4251  tgggggcgga ttggctgtat gtcatgtaag tttgaggggt tctatcggag
    4301  ccccccgccc