Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate TW coat protein gene, complete cds.

ACC No: AY383566

Dated: 2003-10-08 | Length: 1047 | CRC: -975021216

                !!NA_SEQUENCE 1.0
ID   AY383566   standard; genomic RNA; VRL; 1047 BP.
XX
AC   AY383566;
XX
SV   AY383566.1
XX
DT   08-OCT-2003 (Rel. 77, Created)
DT   08-OCT-2003 (Rel. 77, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate TW coat protein gene, complete cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1047
RA   Chen C.-C., Lin C.-Y., Ko W.-F., Jan F.-J.;
RT   "Isolation and characterization of Carnation mottle virus from carnation";
RL   Zhi Wu Bing Li Xue Hui Kan 12:199-208(2003).
XX
RN   [2]
RP   1-1047
RA   Jan F.-J.;
RT   ;
RL   Submitted (08-SEP-2003) to the EMBL/GenBank/DDBJ databases.
RL   Department of Plant Pathology, National Chung Hsing University, 250
RL   Kuo-Kuang Road, Taichung, Taiwan 402, Taiwan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1047
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT                   /isolate="TW"
FT   CDS             1. .1047
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AAQ88331.1"
FT                   /translation="MENKGEKIAMNSTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1047 BP; 298 A; 242 C; 285 G; 222 T; 0 other;

AY383566  Length: 1047  October 21, 2003 08:54  Type: N  Check: 2539  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aattccactg tgcaaacgtt
      51  ggcgcagaag ggggacaagt tggccgtgaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgctggatac
     151  actccagcga tcctagcctt tacaccccga cgaccacgga tgacgaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaacta ctatgcaccg tcaaaggtac cacgggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtctt
     351  ccctcaactc tcgctgctag cgacgaactt caacaagtat cgcatcactg
     401  cgcttactgt gaagtactca cccgcgtgca gttttgagac aaatgggagg
     451  gtggctctag gattcaacga tgacgcttcg gacacaccgc caaccaccaa
     501  ggttggattt tacgatctgg gcaaacatgt ggaaactgct gcacagacag
     551  ctaaggatct agtgatacca gtagacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttgggcgaa tagtcttgtc
     651  aacatacggg tttgacaagg ctgacactgt ggtgggcgaa ttgtttatac
     701  agtacacgat tgtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagtaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  taatggcaac gagctacaat taagagtggt agccgctggg aaatggtgca
     851  ttatagtgcg gggtacggtt gaaggaggct tcaccaaacc cacacttatt
     901  gggccgggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgag ttggtgacac aaatggaggg ccagatattg aagatcacca
    1001  agacctcagc agaacaacca ctccaatggg ttgtttatag gatgtga