Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus RNA for coat protein, complete cds.

ACC No: D29663

Dated: 2005-04-17 | Length: 1173 | CRC: -593049801

                !!NA_SEQUENCE 1.0
ID   MNSCP2     standard; genomic RNA; VRL; 1173 BP.
XX
AC   D29663;
XX
SV   D29663.1
XX
DT   30-NOV-1994 (Rel. 41, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 11)
XX
DE   Melon necrotic spot virus RNA for coat protein, complete cds.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1173
RA   Ohshima K.;
RT   ;
RL   Submitted (24-MAR-1994) to the EMBL/GenBank/DDBJ databases.
RL   Kazusato Ohshima, Saga University, Lab. Plant Virology, Faculty of
RL   Agriculture; 1-banchi, Honjo-machi, Saga, Saga 840-8502, Japan
RL   (E-mail:ohshimak@cc.saga-u.ac.jp, Tel:81-952-28-8730(ex.2730),
RL   Fax:81-952-28-8709)
XX
RN   [2]
RP   1-1173
RX   MEDLINE; 95070805.
RX   PUBMED; 7980005.
RA   Ohshima K., Matsuo K., Sako N.;
RT   "Nucleotide sequences and expression in Escherichia coli of the coat
RT   protein from two strains of melon necrotic spot virus";
RL   Arch. Virol. 138(1-2):149-160(1994).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1173
FT                   /db_xref="taxon:11987"
FT                   /mol_type="genomic RNA"
FT                   /organism="Melon necrotic spot virus"
FT                   /strain="S"
FT   CDS             1. .1173
FT                   /codon_start=1
FT                   /db_xref="GOA:Q83428"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q83428"
FT                   /gene="MNSV-S CP"
FT                   /product="coat protein"
FT                   /protein_id="BAA06135.1"
FT                   /translation="MAMVKRINNLPTVKLAKQALPLLANPKLVNKAIDVVPLVVQSGQK
FT                   LSKAAKRLLGAYGGNISYTEGARPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNVGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHCADSSPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGATAHGDLYVEYAVEFKDPQPIAGMVCMFDRSVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVT
FT                   GGGASALTFTLNSTGIPNNSDSSFSVGTVVGLTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 1173 BP; 268 A; 280 C; 280 G; 345 T; 0 other;

   D29663  Length: 1173  May 10, 2005 10:09  Type: N  Check: 3931  ..

       1  atggcgatgg ttaaacgcat taacaattta ccaacagtga agcttgctaa
      51  acaggccctg cctctcttgg ctaatccgaa attagtgaac aaagctatag
     101  atgtggttcc tttagtagtc caaagtggac agaagttgtc caaagctgcc
     151  aaacggttgc ttggtgctta cgggggcaac atttcttaca ctgagggcgc
     201  cagacctggt gctatttccg cccccgtcgc tattagtcgt cgagtggcgg
     251  gcatgaagcc cagatttgtt agatctgaag gatctgtgaa gatagttcat
     301  agggaattta ttgcttctgt tcttccgtct aatgacctta ctgttaataa
     351  tggtgacgtc aatgttggga agtacagggt caatcctagt aataacgctc
     401  tgttcacatg gcttcaggga caagcgcaat tgtatgatat gtacagattc
     451  acccgcttac gattcaccta tataccaacc accggttcta cttccactgg
     501  tcgagtctct atcctctggg atcgggattc tcaggacccc cttccaattg
     551  atcgtgcagc cattagttct tatgctcatt gtgctgattc gtcgccttgg
     601  gccgagaatg tattagtggt gccctgcgac aatacgtgga ggtacatgaa
     651  tgataccaat gctgtagacc gaaagttggt tgatttcggg caatttctct
     701  ttgctactta ttctggtgct ggtgccactg cccatggtga tctctatgtc
     751  gagtatgctg ttgagtttaa agacccacag ccgatagccg ggatggtttg
     801  catgtttgat cgttcggtct ctttctctga agtcggatcc accatcaagg
     851  gggtgaacta cattgctgat cgcgacgtga taaccactgg gggcaatatt
     901  ggtgtcaaca tcaatatccc tgggacttac ctcgttacga ttgtattgaa
     951  tgccacctcg attggttccc tcaccttcac tggaaattct aaacttgtag
    1001  gcaacagtct taacgtcact ggtggtggag cgtctgcttt gaccttcact
    1051  ctcaattcca caggcattcc caacaatagt gactcatcgt tctctgttgg
    1101  tactgtcgtg ggcttgacga gggttcgcat gacgatcact cggtgctctc
    1151  ctgaaaccgc ctacctcgcc taa