Sequence of DPV Japanese iris necrotic ring virus

Japanese iris necrotic ring virus genomic RNA, complete genome.

ACC No: D86123

Dated: 2005-04-17 | Length: 4014 | CRC: -896869219

                !!NA_SEQUENCE 1.0
ID   D86123     standard; genomic RNA; VRL; 4014 BP.
XX
AC   D86123;
XX
SV   D86123.1
XX
DT   17-MAR-2000 (Rel. 63, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Japanese iris necrotic ring virus genomic RNA, complete genome.
XX
KW   capsid protein (p38); movement protein (p12); movement protein (p8);
KW   readthrough protein (p85); readthrough protein (p99); replicase (p26).
XX
OS   Japanese iris necrotic ring virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4014
RA   Takemoto Y.;
RT   ;
RL   Submitted (20-JUN-1996) to the EMBL/GenBank/DDBJ databases.
RL   Yutaka Takemoto, The University of Tokyo, Department of Agricultural and
RL   Environmental Biology; 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113, Japan
RL   (E-mail:aa57007@mail.ecc.u-tokyo.ac.jp, Tel:03-5841-5054, Fax:03-5841-5090)
XX
RN   [2]
RX   DOI; 10.1007/s007050050054.
RX   MEDLINE; 20254547.
RX   PUBMED; 10795530.
RA   Takemoto Y., Kanehira T., Shinohara M., Yamashita S., Hibi T.;
RT   "The nucleotide sequence and genome organization of Japanese iris necrotic
RT   ring virus, a new species in the genus Carmovirus";
RL   Arch. Virol. 145(3):651-657(2000).
XX
CC   Sequence updated (26-May-1999)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4014
FT                   /db_xref="taxon:77344"
FT                   /mol_type="genomic RNA"
FT                   /organism="Japanese iris necrotic ring virus"
FT                   /lab_host="Iris ensata"
FT   CDS             32. .2698
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9IRA2"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9IRA2"
FT                   /note="ORF3"
FT                   /transl_except=(pos:764. .766,aa:OTHER)
FT                   /transl_except=(pos:2318. .2320,aa:OTHER)
FT                   /product="readthrough protein (p99)"
FT                   /protein_id="BAA92791.1"
FT                   /translation="MLWYEELTMSLLGSRFVPKPLAIVGGLSLCVTVAVRETVQDGISM
FT                   GLSSFGDYCRNKVQAGLNPLDVSHDFKQATPQHPSMDLMLDNPQLCEEPEDCLEVLVAN
FT                   EQVTKKRVNRHARGTFAAHAAMACKLHFGLVPMNTRANLSVATRFITNYCQERHVVPTH
FT                   TRAVVDAAIPLVFTPDSGEIGILVALNHRESQIRRLAAREATIQQTPLAELVTAPWCGA
FT                   SWVRVARVLSGYEDFTTFHFSNXGGLREMGGVETQIVRGAHPSLTVSREKPASKVRRIY
FT                   QITGLDSGINFGVHNNSLNNLRRGLIERVYYVESNGVLQPPLKPKVHQFRKLKYFARRL
FT                   VNIVGPYTPIEREEYPLLYQGRRKAIYQKALESLSERPCTRKDAKLRTFVKAEKINFTS
FT                   KGDPAPRVIQPRDPRYNIEVGKYLKKAEHHIYSAIDRIWGGPTVLKGYTVEQLGTNIAN
FT                   IWSQFQRPCAVGFDAKRFDQHVSVDALRFEHSVYNSIFHSPELARLLSYQLHNVGVAVA
FT                   SDGFARYSVDGCRMSGDINTALGNCLLSCAITHFLCRGIRCRLINNGDDCVLFFESSDL
FT                   TLVNERLTKWSDFGFSVKFEEPVYELERVEFCQMQPIYAGGWVMCRNPYICTSKDTYSI
FT                   TPWHNPKSALKWVASVGECGLSLCGGIPVLQSFYSCMMAQSDERMNIKNDVWFSDSGFA
FT                   RLASNGKRTREHVSTEARISFWKAFGILPETQVSLEGVFHSYENCKAFGAGGINCELWT
FT                   QLLKPQRMNXILQVKNYRLSSERYKMPGAVKRLRGLLRGMLRCLQFALWLVGKLLVGFG
FT                   CRSARPSPQPTIFTSEPLWDNDLLLVLIISLTFTLIYIFAQQQPVHHHHYSESNHKTQH
FT                   ITIGTESQTRQIPNGAT"
FT   CDS             32. .2320
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9IRA1"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="InterPro:IPR007095"
FT                   /db_xref="UniProt/TrEMBL:Q9IRA1"
FT                   /note="ORF2"
FT                   /note="putative replicase"
FT                   /transl_except=(pos:764. .766,aa:OTHER)
FT                   /product="readthrough protein (p85)"
FT                   /protein_id="BAA92792.1"
FT                   /translation="MLWYEELTMSLLGSRFVPKPLAIVGGLSLCVTVAVRETVQDGISM
FT                   GLSSFGDYCRNKVQAGLNPLDVSHDFKQATPQHPSMDLMLDNPQLCEEPEDCLEVLVAN
FT                   EQVTKKRVNRHARGTFAAHAAMACKLHFGLVPMNTRANLSVATRFITNYCQERHVVPTH
FT                   TRAVVDAAIPLVFTPDSGEIGILVALNHRESQIRRLAAREATIQQTPLAELVTAPWCGA
FT                   SWVRVARVLSGYEDFTTFHFSNXGGLREMGGVETQIVRGAHPSLTVSREKPASKVRRIY
FT                   QITGLDSGINFGVHNNSLNNLRRGLIERVYYVESNGVLQPPLKPKVHQFRKLKYFARRL
FT                   VNIVGPYTPIEREEYPLLYQGRRKAIYQKALESLSERPCTRKDAKLRTFVKAEKINFTS
FT                   KGDPAPRVIQPRDPRYNIEVGKYLKKAEHHIYSAIDRIWGGPTVLKGYTVEQLGTNIAN
FT                   IWSQFQRPCAVGFDAKRFDQHVSVDALRFEHSVYNSIFHSPELARLLSYQLHNVGVAVA
FT                   SDGFARYSVDGCRMSGDINTALGNCLLSCAITHFLCRGIRCRLINNGDDCVLFFESSDL
FT                   TLVNERLTKWSDFGFSVKFEEPVYELERVEFCQMQPIYAGGWVMCRNPYICTSKDTYSI
FT                   TPWHNPKSALKWVASVGECGLSLCGGIPVLQSFYSCMMAQSDERMNIKNDVWFSDSGFA
FT                   RLASNGKRTREHVSTEARISFWKAFGILPETQVSLEGVFHSYENCKAFGAGGINCELWT
FT                   QLLKPQRMN"
FT   CDS             32. .766
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q9IRA0"
FT                   /note="ORF1"
FT                   /note="putative"
FT                   /product="replicase (p26)"
FT                   /protein_id="BAA92793.1"
FT                   /translation="MLWYEELTMSLLGSRFVPKPLAIVGGLSLCVTVAVRETVQDGISM
FT                   GLSSFGDYCRNKVQAGLNPLDVSHDFKQATPQHPSMDLMLDNPQLCEEPEDCLEVLVAN
FT                   EQVTKKRVNRHARGTFAAHAAMACKLHFGLVPMNTRANLSVATRFITNYCQERHVVPTH
FT                   TRAVVDAAIPLVFTPDSGEIGILVALNHRESQIRRLAAREATIQQTPLAELVTAPWCGA
FT                   SWVRVARVLSGYEDFTTFHFSN"
FT   CDS             2284. .2514
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9IR99"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProt/TrEMBL:Q9IR99"
FT                   /note="ORF4"
FT                   /note="putative"
FT                   /product="movement protein (p8)"
FT                   /protein_id="BAA92794.1"
FT                   /translation="MDSASETTTYELDPPGEELPTVKREIQNARGSQATKRAVARDAAL
FT                   STVRSVASREVVGGVWVQVGETFTTTNHFHF"
FT   CDS             2366. .2698
FT                   /codon_start=1
FT                   /db_xref="UniProt/TrEMBL:Q9IR98"
FT                   /note="ORF5"
FT                   /note="putative"
FT                   /product="movement protein (p12)"
FT                   /protein_id="BAA92795.1"
FT                   /translation="MPGAVKRLRGLLRGMLRCLQFALWLVGKLLVGFGCRSARPSPQPT
FT                   IFTSEPLWDNDLLLVLIISLTFTLIYIFAQQQPVHHHHYSESNHKTQHITIGTESQTRQ
FT                   IPNGAT"
FT   CDS             2685. .3743
FT                   /codon_start=1
FT                   /db_xref="GOA:Q9IR97"
FT                   /db_xref="HSSP:2TBV"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProt/TrEMBL:Q9IR97"
FT                   /note="ORF6"
FT                   /product="capsid protein (p38)"
FT                   /protein_id="BAA92796.1"
FT                   /translation="MALRDEKKVAKLASDGVAWAVKLRSGGGWKTLTTTQKRMARQALG
FT                   MTQVPIAQTGLRVNRVSQPISVSSRITTGEPRVTNVKRSMTVTFSEMIGVVRSHSSLST
FT                   ESWVLNPSDIATFPQLSVSAAMYEKYRFTNLAFRFAPSCPTTTGGVVVLVHDPDSSDDL
FT                   PSDPTMLYEYSGAMRTSAYSPARLIVPTDGAARFVGDNHTSDPKLINFGKLIVANYGQG
FT                   ASDPDMLGEIFIEYTVVLIDRQPSALSTQTLSAESSTGPKLLSRLVEGTKSPYTLTYSF
FT                   NCGGTFVVSLFYPIGPVSGPVSGSATIIRAYGDAQSQQAQVITVRSPCRGGDFTLGLNS
FT                   PGDIPTAFVTRA"
XX
SQ   Sequence 4014 BP; 990 A; 1008 C; 1061 G; 955 T; 0 other;

   D86123  Length: 4014  May 10, 2005 10:09  Type: N  Check: 5550  ..

       1  gggtaaacga gtatatatac aacgtgaacc catgttgtgg tacgaggagt
      51  tgacgatgag tctactaggg tcgaggtttg tgcctaagcc tctggcgatc
     101  gttggtgggc tgtctctctg tgtgactgtc gctgtgcggg aaactgtgca
     151  agatggcatc tccatggggc tcagttcatt tggcgattac tgtaggaaca
     201  aggtccaagc cggattaaac ccgctggacg tcagccacga cttcaagcaa
     251  gcgacaccgc aacatcctag catggacctc atgctggaca atccccagtt
     301  gtgcgaagaa ccggaggatt gccttgaggt cctggtggcg aacgagcaag
     351  tgaccaagaa acgggtcaat cgccacgcta ggggaacatt cgccgcccac
     401  gccgctatgg cctgtaaact gcacttcggg ttggttccaa tgaacacgcg
     451  ggccaacctc agcgtagcaa ccaggttcat caccaactat tgccaggaga
     501  ggcacgtcgt gccaacccac acgcgggcag tagtggatgc agccatccct
     551  ctcgtattca cccctgactc tggtgagatc ggcattcttg tcgcattaaa
     601  ccatcgcgag agtcagatca ggaggttggc agcgcgtgag gcaacaattc
     651  agcaaacacc cctggctgaa ttggtaaccg ctccttggtg tggggcgagt
     701  tgggtgaggg tggccagagt tctcagtggg tatgaggact ttaccacctt
     751  ccatttctcc aactaggggg gtctccgcga gatggggggg gtagaaacac
     801  agattgttcg aggcgcccac cccagtctca ccgtctcgcg ggaaaagcca
     851  gcctccaagg ttcgcagaat ttaccaaatt actgggttgg atagtggcat
     901  caattttggc gtgcacaaca atagtttgaa taacttgcgc cgaggtttaa
     951  ttgagcgtgt ctactatgtc gaatccaatg gtgttttgca acctccgttg
    1001  aagccaaagg tgcaccaatt ccgcaaactc aagtacttcg cccgtcgttt
    1051  ggtaaacatt gttggaccgt ataccccgat cgagagggag gaataccctc
    1101  tcttgtatca gggcaggcgt aaggcaatct accagaaggc gttagagtcc
    1151  ctgagtgagc gaccatgcac aagaaaggac gccaaactcc ggacctttgt
    1201  caaagccgag aagataaatt tcacctctaa gggtgaccca gcccccaggg
    1251  taatccaacc cagggaccct cgatacaata tcgaggttgg gaagtaccta
    1301  aagaaggctg aacatcacat atactccgct attgacagaa tatggggggg
    1351  tcctactgta ctaaaggggt acacagtgga gcaactggga accaacattg
    1401  ccaacatctg gtcccaattc cagagacctt gtgctgtagg ttttgatgcc
    1451  aagagattcg atcagcacgt ctctgtagat gccctaagat ttgagcattc
    1501  tgtttacaat tcgattttcc acagccctga gttggctaga ctacttagct
    1551  accaactcca taacgtgggt gtggccgtgg cctctgatgg atttgccagg
    1601  tattccgtgg atggatgtag aatgagcggt gacatcaaca cagcgttggg
    1651  taattgcctg ctgagttgtg ccatcaccca cttcctgtgt aggggcataa
    1701  ggtgtagact catcaacaac ggcgatgact gcgtcctctt cttcgaaagt
    1751  tccgatttga ccctcgtcaa tgagcgtttg acgaaatggt ccgacttcgg
    1801  gttttctgtc aagtttgagg aaccggtata cgagcttgaa cgtgttgagt
    1851  tttgccaaat gcaaccaatt tacgcgggag gttgggtcat gtgccgtaac
    1901  ccttacatat gcacttctaa ggacacctat agcatcacgc catggcacaa
    1951  tcccaaaagc gcactcaaat gggtcgcttc agttggggag tgtggattat
    2001  cactttgtgg gggcatacca gtgttgcaga gtttttacag ttgcatgatg
    2051  gcgcagagtg atgagaggat gaatatcaaa aacgatgtgt ggttttcgga
    2101  cagcgggttc gcaagattgg cctccaatgg caagcgcact agagagcatg
    2151  tgagtaccga agccaggatt tccttctgga aagcttttgg tatccttcct
    2201  gagacacagg tgtccctgga aggggtgttc cactcttatg aaaattgcaa
    2251  agcatttggt gcggggggta taaactgcga actatggact cagcttctga
    2301  aaccacaacg tatgaactag atcctccagg tgaagaatta ccgactgtca
    2351  agcgagagat acaaaatgcc aggggcagtc aagcgactaa gagggctgtt
    2401  gcgcgggatg ctgcgttgtc tacagttcgc tctgtggcta gtcgggaagt
    2451  tgttggtggg gtttgggtgc aggtcggcga gaccttcacc acaaccaacc
    2501  attttcactt ctgagcccct ctgggataac gaccttctcc ttgtgctaat
    2551  aatctcactc accttcactc ttatatatat atttgctcaa caacaaccag
    2601  tgcaccatca ccactactct gaaagcaatc ataagacaca gcacatcaca
    2651  atcggcaccg aaagtcagac tcgacaaatt cccaatggcg ctacgtgatg
    2701  aaaagaaagt tgcgaagcta gcctctgatg gagtagcctg ggctgtcaag
    2751  ctcagatctg gtgggggttg gaaaaccctc accactaccc aaaagaggat
    2801  ggctagacaa gcgctgggaa tgactcaagt gcccatagcc caaactgggt
    2851  tgcgggtaaa tcgtgtgtcc cagccaatct ctgtgtcctc taggatcacg
    2901  actggtgaac cccgtgtaac caacgttaaa cgcagtatga ctgtcacttt
    2951  ttccgagatg attggtgtag taaggtcaca ctccagcttg tccacggagt
    3001  cttgggtcct caacccaagt gacattgcta cgttccctca attatccgtt
    3051  tctgctgcga tgtacgagaa gtacaggttc accaatctag ccttcagatt
    3101  tgctccaagt tgccctacga ccacaggtgg agtagtagta ttagtccacg
    3151  accctgattc gagcgacgac ctccctagcg accctaccat gttatatgag
    3201  tattcaggag ctatgcgaac cagtgcttac agcccagctc gcctcattgt
    3251  tccaactgac ggcgcagcca ggtttgtcgg cgacaatcac acaagtgacc
    3301  cgaagctgat caacttcggg aagctcattg ttgccaatta tggacaagga
    3351  gcatctgatc ctgatatgtt gggggagatc tttatcgagt atactgttgt
    3401  gcttattgat cggcagccat ctgcattgag tacacagaca ttatcggctg
    3451  aatcatcgac aggacctaag ctactctccc ggttggtcga gggaaccaag
    3501  agcccctaca cccttacgta cagcttcaac tgtggtggta cctttgttgt
    3551  cagtttgttc taccccatcg gaccagtttc cggaccagta tccgggtcag
    3601  ctactattat ccgagcctat ggggacgcac agagccaaca ggcacaagtt
    3651  atcaccgtta ggtcaccatg cagaggcgga gacttcaccc ttggactgaa
    3701  tagtccaggt gacataccca ccgcctttgt cacccgtgct tagaaacgac
    3751  cattcttggg tttgcagcga gatgccacgt gccagaggat agtaccactg
    3801  gctgacccta ccagcgtttg cgagttggta tgcgtggatg taaattccaa
    3851  gtcttgtgtc cgacctaggc tccgccggct ggagctcgca tgtggcagtg
    3901  cgagcagagg atgtcccgat gcataaaatc ccgtgagggt gggcttgcta
    3951  gggaggccga cactgcgtaa tgcaaaacta cccttttccc ctgtgagggg
    4001  gaagaggggg gccc