Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate Mahallat-1 coat protein (CP) gene, complete cds.

ACC No: DQ092485

Dated: 2005-07-05 | Length: 1047 | CRC: 524667243

                !!NA_SEQUENCE 1.0
ID   DQ092485   standard; genomic RNA; VRL; 1047 BP.
XX
AC   DQ092485;
XX
SV   DQ092485.1
XX
DT   05-JUL-2005 (Rel. 84, Created)
DT   05-JUL-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate Mahallat-1 coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1047
RA   Hashemi Sohi H., Barzegar A., Aazaadi P., Shafiee M.R., Riazifar A.;
RT   "Carnation mottle virus CP gene for coat protein, genomic RNA, isolate
RT   Mahallat-1";
RL   Unpublished.
XX
RN   [2]
RP   1-1047
RA   Hashemi Sohi H., Barzegar A., Aazaadi P., Shafiee M.R., Riazifar A.;
RT   ;
RL   Submitted (13-JUN-2005) to the EMBL/GenBank/DDBJ databases.
RL   Plant Biotechnology, NICGEB, Tehran 14155-6343, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1047
FT                   /country="Iran"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT                   /isolate="Mahallat-1"
FT   gene            1. .1047
FT                   /gene="CP"
FT   CDS             1. .1047
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AAY96765.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLAMNFNKYRITALTVRYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTIEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKITKTAAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1047 BP; 307 A; 249 C; 278 G; 213 T; 0 other;

 DQ092485  Length: 1047  July 12, 2005 08:41  Type: N  Check: 6291  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaaacatt
      51  ggcgcagaag ggggataagt tagccgtaaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgctggatac
     151  actccagcga tcctagcctt cacaccccga cgaccacgga tgacgaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaacta ctaagcaccg tcaaaggtac cacgggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtctt
     351  ccctcaactc tcgctgctag cgatgaactt caacaagtac cgcatcactg
     401  cgctcactgt gaggtattca cccgcgtgca gcttcgagac caatgggagg
     451  gtggctctgg gattcaacga tgacgcttcg gacacaccac caaccaccaa
     501  ggttggattt tacgatctag gcaaacatgt ggaaactgct gcacagacag
     551  ccaaggatct agtgatacca gtagacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttggacgaa tagtcttgtc
     651  aacatacggg tttgacaagg ctgacactgt ggtgggcgaa ttgtttatac
     701  agtacacgat cgtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  caatggcaac gagctacaac taagagtggt agccgctgga aaatggtgca
     851  ttatagtgcg gggtacgata gagggaggct ttaccaaacc cacacttatt
     901  ggaccgggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgaa ttggtgacac aaatggaggg ccagatattg aaaatcacca
    1001  agaccgcagc agaacaacca cttcaatggg ttgtttatag gatgtga