Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate Mahallat-2 coat protein (CP) gene, complete cds.

ACC No: DQ092486

Dated: 2005-07-05 | Length: 1047 | CRC: -1180085827

                !!NA_SEQUENCE 1.0
ID   DQ092486   standard; genomic RNA; VRL; 1047 BP.
XX
AC   DQ092486;
XX
SV   DQ092486.1
XX
DT   05-JUL-2005 (Rel. 84, Created)
DT   05-JUL-2005 (Rel. 84, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate Mahallat-2 coat protein (CP) gene, complete
DE   cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1047
RA   Hashemi Sohi H., Barzegar A., Aazaadi P., Shafiee M.R., Riazifar A.;
RT   "Carnation mottle virus CP gene for coat protein, genomic RNA, isolate
RT   Mahallat-2";
RL   Unpublished.
XX
RN   [2]
RP   1-1047
RA   Hashemi Sohi H., Barzegar A., Aazaadi P., Shafiee M.R., Riazifar A.;
RT   ;
RL   Submitted (13-JUN-2005) to the EMBL/GenBank/DDBJ databases.
RL   Plant Biotechnology, NICGEB, Tehran 14155-6343, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1047
FT                   /country="Iran"
FT                   /db_xref="taxon:11986"
FT                   /mol_type="genomic RNA"
FT                   /organism="Carnation mottle virus"
FT                   /isolate="Mahallat-2"
FT   gene            1. .1047
FT                   /gene="CP"
FT   CDS             1. .1047
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AAY96766.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1047 BP; 304 A; 248 C; 280 G; 215 T; 0 other;

 DQ092486  Length: 1047  July 12, 2005 08:41  Type: N  Check: 7605  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaaacatt
      51  ggcgcagaag ggggacaagt tagccgtgaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgctggatac
     151  acaccagcga tcctagcctt cacaccccga cgaccacgga tgacgaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaactg ctaagcaccg tcaaaggtac cacgggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtctt
     351  ccctcaactc tcgctgctgg cgacgaactt caacaagtac cgcattactg
     401  cgctcactgt gaagtactca cccgcgtgca gcttcgagac caatgggagg
     451  gtggctctag gattcaatga tgacgcttcg gatacaccac caaccaccaa
     501  ggttggattt tacgatctgg gcaaacatgt ggaaactgct gcacagacag
     551  ccaaggatct agtgatacca gtagacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttggacgaa tagtcttgtc
     651  aacatacggg tttgacaagg ctgacactgt ggtgggcgaa ttgtttatac
     701  agtacacgat cgtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  taatggcaac gagctacaac taagagtggt agccgctggg aaatggtgca
     851  ttatagtgcg gggtacggtt gaaggaggct tcaccaaacc cacacttatt
     901  gggccgggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgaa ttggtaacac aaatggaggg ccagatattg aaaattacca
    1001  agacctcagc agaacaacca cttcaatggg ttgtttatag gatgtga