Sequence of DPV Angelonia flower break virus

Angelonia flower break virus isolate Maryland coat protein (CP) gene, complete cds.

ACC No: DQ221212

Dated: 2007-01-31 | Length: 1096 | CRC: -662584089

                
ID   DQ221212; SV 1; linear; genomic RNA; STD; VRL; 1096 BP.
XX
AC   DQ221212;
XX
DT   22-DEC-2005 (Rel. 86, Created)
DT   31-JAN-2007 (Rel. 90, Last updated, Version 2)
XX
DE   Angelonia flower break virus isolate Maryland coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Angelonia flower break virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1096
RA   Adkins S.T., Hammond J., Maroon-Lango C.J., Harness A., Kulemeka B.,
RA   Geister R., Bandla M., Spiegel S., Gera A.;
RT   "Characterization of a Carmovirus from Angelonia";
RL   Phytopathology 95(6):S2-S2(2005).
XX
RN   [2]
RP   1-1096
RA   Adkins S., Hammond J., Gera A., Maroon-Lango C.J., Sobolev I., Harness A.,
RA   Zeidan M., Spiegal S.;
RT   "Biological and Molecular Characterization of a Novel Carmovirus Isolated
RT   from Angelonia";
RL   Phytopathology 96:460-467(2006).
XX
RN   [3]
RP   1-1096
RA   Maroon-Lango C.J., Hammond J.;
RT   ;
RL   Submitted (23-SEP-2005) to the EMBL/GenBank/DDBJ databases.
RL   Floral and Nursery Plants Research Unit, US National Arboretum, USDA-ARS,
RL   10300 Baltimore Avenue, Beltsville, MD 20705, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1096
FT                   /organism="Angelonia flower break virus"
FT                   /specific_host="Angelonia cv. 'Angelface Blue'"
FT                   /isolate="Maryland"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Maryland"
FT                   /db_xref="taxon:352882"
FT   gene            1. .1096
FT                   /gene="CP"
FT   CDS             7. .1062
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q2Q468"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:Q2Q468"
FT                   /protein_id="ABB30148.1"
FT                   /translation="MSNLRNDPRVAKLAAQGSAWAKRLMNNGWGGLRPNQKAAARQALG
FT                   ILPAPVATPVTTTRLVNGNPTNQRRKRNQPGNLRTDTPVTSTEFFADVLLHTGEDANIR
FT                   SWVVNPREVSLFPRLSIQSALYDKYRISSLRVRFASSCSFEVNGKIMLGFIGDSSDEVP
FT                   VTKIDVHSLTKTAECTAMQNIIFNVGGDNITRFLGDRASDDPKLVNFGRIVLCTYGFDS
FT                   NAPSIVGELSIEYTITLLNPSPVASLSQRWISGNSKGIRFVEYTHNVVTKTYQFVFRTG
FT                   GRYCLVVATDKGVFGSPLVTGSVQTQSRVVTDGTATLMTVSVDMKAPNGTISWIPPTDQ
FT                   GALTEWIVTRV"
XX
SQ   Sequence 1096 BP; 268 A; 327 C; 259 G; 242 T; 0 other;

dq221212 Length: 1096  31-JAN-2007  Type: N  Check: 7811  ..

       1  catacgatga gcaatctccg caacgacccg cgagtcgcaa agcttgccgc
      51  ccaaggctca gcctgggcca agcgactcat gaacaatggt tggggtgggc
     101  ttcgaccaaa tcagaaagct gcagcacggc aagcactggg aatcctcccc
     151  gctcctgttg ccactcccgt aaccaccact aggttagtca acggtaaccc
     201  caccaaccaa aggcgtaaac gcaatcaacc tggcaatctg cgtactgaca
     251  cgccagtcac cagcaccgaa ttcttcgctg acgtactgtt acacactgga
     301  gaggacgcaa acatccgctc gtgggtcgtc aaccctcgag aggtcagcct
     351  cttccctcga ctctctatcc aatccgcatt gtacgacaag taccgcattt
     401  catctctccg agttcgtttc gcttcctctt gctcgtttga agtgaacgga
     451  aagatcatgc tcgggttcat tggggattcc tctgatgaag tgcccgtcac
     501  aaagatcgac gttcactccc tcactaagac agcagagtgc actgccatgc
     551  agaacattat ctttaacgtg ggaggagaca acatcacccg cttcctcggt
     601  gatagggcga gcgacgaccc aaaacttgtc aacttcggcc gcatcgtgct
     651  ttgcacttac ggcttcgaca gcaatgcacc atccatcgtc ggagagttgt
     701  ccattgagta caccattact ctactcaatc cgtcccctgt cgctagtcta
     751  tctcaaaggt ggattagcgg caactccaag ggaattcggt tcgtggagta
     801  cacacacaat gtcgtgacga aaacttacca gttcgtcttc cgaacaggag
     851  gacggtactg tcttgttgtt gccacggaca aaggggtctt tggatctccc
     901  ctcgtaacag gctcagttca aacacagtca cgtgtggtga ctgacggaac
     951  cgccacgctc atgacggtat ccgtagatat gaaagcacct aacggcacca
    1001  tcagttggat tccgccaaca gatcagggtg cacttactga gtggattgtc
    1051  actcgggtat aacggctggt caccgtacct cccagtccga tagcgc