Sequence of DPV Pelargonium flower break virus

Pelargonium flower break virus isolate SP18, complete genome.

ACC No: DQ256073

Dated: 2006-04-05 | Length: 3923 | CRC: 271885556

                
ID   DQ256073   standard; genomic RNA; VRL; 3923 BP.
XX
AC   DQ256073;
XX
SV   DQ256073.1
XX
DT   05-APR-2006 (Rel. 87, Created)
DT   05-APR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Pelargonium flower break virus isolate SP18, complete genome.
XX
KW   .
XX
OS   Pelargonium flower break virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3923
RA   Rico P., Hernandez C.;
RT   "Infectivity of in vitro transcripts from a full-length cDNA clone of
RT   Pelargonium flower break virus in an experimental and a natural host";
RL   J. Plant Pathol. 88(1):103-106(2006).
XX
RN   [2]
RP   1-3923
RA   Rico P., Hernandez C.;
RT   ;
RL   Submitted (21-OCT-2005) to the EMBL/GenBank/DDBJ databases.
RL   IBMCP, CSIC, Avenida de lo Naranjos, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3923
FT                   /organism="Pelargonium flower break virus"
FT                   /specific_host="Pelargonium x hortorum"
FT                   /lab_host="Chenopodium quinoa"
FT                   /isolate="SP18"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain"
FT                   /db_xref="taxon:35291"
FT   gene            33. .2303
FT                   /gene="p86"
FT   CDS             33. .2303
FT                   /codon_start=1
FT                   /transl_except=(pos:762. .764,aa:OTHER)
FT                   /gene="p86"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="translation requires read-through of stop codon"
FT                   /protein_id="ABB79925.1"
FT                   /translation="MLRFGSQLVVGSTLIGGLTAVGLAGLSVRATIGVVEFNLRCARVV
FT                   GDIIRDPFNALPSAPLFPGPSVEVFAEEVRKDLEPELEAKDYLVIHEEKEVDEEGKSKV
FT                   VRQRSTVNRHKKGRFVHRLVCDGKNHFGGTPSASRANELAVMKYLVGKCREHRLVVQHT
FT                   REVCSLAMAAIFTPDHHEVNMVREMNSHAAYRRRVALADAARVHSWQQELLRSPLSWNA
FT                   WGRAWWIANGLPDREPVRFTKXGGLFCLEGVETGVRRGTHPQMIEVEKNSPPKLRKLFA
FT                   QRLVSSGVEYRVHNHSFQNLRRGVLERVFYVEENKQLVSCPCPEKGAFKEMGYLRRQFV
FT                   RLTPKHARISAKEFVDCYHGRKKSVYEFAAMTLSERPLDRKDASLKTFIKAEKFCKADP
FT                   APRVIQPRSPRYNVELGRYLKKFEHSAYRTLDKIWGGKTVMKGYSVDEIGKHISEAWDS
FT                   FHSPVAVGFDMSRFDQHVSVPALQFEHSCYLACFPGDQHLAELLSWQLKNFGVGFASNG
FT                   MVRYKKDGCRMSGDMNTALGNCLLACLITRHLMKDINCRLVNNGDDCVLFLDKKDLPFV
FT                   VSNLTTGWRRFGFKCIAEEPVYELEHVRFCQMAPVYDGSQYVMLRDPFVSMSKDSFSLT
FT                   HWNTTKNAKQWMKSVGICGERITGGLPVVQEYYRKYQEIAGDVKFSHSLEITSSGTYRL
FT                   AQNSSRAYGSVSEMARFSFFLAFGVIPDAQIALEKHIRDMPVAAEFGPDESLADHTIEW
FT                   LLK"
FT   gene            33. .764
FT                   /gene="p27"
FT   CDS             33. .764
FT                   /codon_start=1
FT                   /gene="p27"
FT                   /product="putative polymerase-associated protein"
FT                   /protein_id="ABB79924.1"
FT                   /translation="MLRFGSQLVVGSTLIGGLTAVGLAGLSVRATIGVVEFNLRCARVV
FT                   GDIIRDPFNALPSAPLFPGPSVEVFAEEVRKDLEPELEAKDYLVIHEEKEVDEEGKSKV
FT                   VRQRSTVNRHKKGRFVHRLVCDGKNHFGGTPSASRANELAVMKYLVGKCREHRLVVQHT
FT                   REVCSLAMAAIFTPDHHEVNMVREMNSHAAYRRRVALADAARVHSWQQELLRSPLSWNA
FT                   WGRAWWIANGLPDREPVRFTK"
FT   gene            2288. .2494
FT                   /gene="p7"
FT   CDS             2288. .2494
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /protein_id="ABB79926.1"
FT                   /translation="MASKVIVPDLGSDNEIDVPVGGRGNRGKQKGKISVAKDAVSKRTS
FT                   DGGNGGSWVVVAETVSVNIHFNF"
FT   gene            2328. .2648
FT                   /gene="p12"
FT   CDS             2328. .2648
FT                   /codon_start=1
FT                   /gene="p12"
FT                   /product="putative movement protein"
FT                   /protein_id="ABB79927.1"
FT                   /translation="MRLTCQWEDVGIGGNRRVRYPSQRTLSPNGHLMVVMGVLGLLWLR
FT                   PFRSIYTSTFSMPPLINLQHILNLTLLSLILSSFILAERVTHNHYSNDNSKAQYIRIST
FT                   GQ"
FT   gene            2650. .3687
FT                   /gene="CP"
FT   CDS             2650. .3687
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="ABB79928.1"
FT                   /translation="MDVYKNDPIVRQAVAKGVAWAVKLNTRGWSSLTTQQKKAARSALS
FT                   VIQSPAVVVPRRTRVRNPVPAGLKSGNGKAGKSSTLTRSEFICNVSSTTGVTPTFQSWI
FT                   INPREVKSFPQSSVCSVGYNKYRITDFRIRFSTSCSDTMNGKVAIGFTPDSSDPVPVDK
FT                   SQLYGMQVYADTPAKESVTLKTAADNTIRFLRDSSSDDAKLVDYGRVVLATYGFDSTAP
FT                   SVIGELFFEYTVVYLDPTYVVALTQHGTLTTSSGPPYATLTTTATSTSMELNTHGKWLV
FT                   VWVSADEVINSPVISGSGASGSVTVVSDAQTTVVAVVTANLPGAIISNTSTAAPSSLEW
FT                   YVSRL"
XX
SQ   Sequence 3923 BP; 991 A; 927 C; 1085 G; 920 T; 0 other;

dq256073 Length: 3923  05-APR-2006  Type: N  Check: 5951  ..

       1  gggatacatt acactcggta tctggttcca acatgctacg attcggatct
      51  cagttagtgg tgggttctac cttaatcggt ggtctcactg ctgtcgggct
     101  ggcaggcctg agcgtgcgtg ctacaatagg tgtagtggaa ttcaacctcc
     151  gctgtgctag agtggtgggt gacatcatac gtgacccatt taatgccctc
     201  ccttcggccc ctctattccc cgggcccagc gttgaggttt tcgctgagga
     251  ggtgaggaag gacctcgagc cggagcttga ggctaaggat tacctcgtca
     301  tccacgagga aaaagaagtg gatgaggagg ggaagagcaa ggtggttagg
     351  cagaggtcta ctgtcaaccg ccacaagaag ggccggtttg tccatcggct
     401  agtctgtgat gggaaaaacc actttggtgg gaccccttca gctagccggg
     451  ccaacgagct ggccgtaatg aagtatctcg tgggtaagtg ccgcgagcac
     501  cgcttagtgg tgcagcacac ccgcgaagtc tgctctctgg cgatggctgc
     551  tattttcacc ccagaccacc atgaagtaaa catggttagg gagatgaaca
     601  gccacgctgc ctaccgaaga agggtagctc ttgcagatgc cgccagagtc
     651  catagctggc agcaggagct actccgctca cccctgagtt ggaacgcttg
     701  ggggagggcg tggtggatag ccaacgggct tcctgacagg gagcctgtcc
     751  ggttcaccaa ataggggggt cttttctgcc tcgagggtgt tgaaacagga
     801  gtccgtaggg ggacgcaccc acagatgatc gaggtagaga aaaactcccc
     851  cccgaaactt aggaaactct tcgcccaacg gttggttagc agtggagttg
     901  aataccgcgt gcataaccac tcgtttcaaa acctaaggcg aggtgtgctt
     951  gagagagttt tctacgtgga agaaaataag cagttagtat cgtgtccctg
    1001  tccggaaaag ggggccttca aggaaatggg ttacctacga aggcaattcg
    1051  ttagacttac tcccaaacat gccaggatct cagcaaagga atttgttgat
    1101  tgctatcatg gtaggaagaa gagtgtctac gagtttgctg ccatgaccct
    1151  ctctgagaga cctctggacc gcaaggatgc cagcttgaag acgtttataa
    1201  aggccgaaaa attttgcaag gccgacccag ctccccgggt tatacaacca
    1251  agaagtccgc gctacaacgt tgaattaggc cgatatctca agaaattcga
    1301  acactcggcc tacagaacgc tggacaagat ctggggagga aagaccgtga
    1351  tgaaagggta ctctgtggat gagataggga aacatatctc agaggcgtgg
    1401  gattcattcc actctccggt tgctgtcgga ttcgacatga gccggttcga
    1451  ccagcacgtt agtgtgcctg cgcttcaatt cgaacacagt tgttaccttg
    1501  cctgttttcc cggagaccag catttggcgg aactcttgag ctggcagctc
    1551  aagaattttg gcgtagggtt cgcgtcaaat ggaatggtta gatataagaa
    1601  ggatgggtgt agaatgtccg gagacatgaa cactgcactg ggaaactgcc
    1651  tattggcttg cctcataact aggcacctca tgaaggacat aaattgtcga
    1701  ctcgtcaaca acggggatga ctgtgtattg ttcttggata aaaaggacct
    1751  cccattcgtc gtgagtaatt taacgacggg ctggcgtagg ttcgggttca
    1801  agtgcattgc agaggagcca gtatacgagc tagagcacgt gaggttttgt
    1851  cagatggccc cagtgtatga tggatcgcaa tacgtcatgt tgcgtgatcc
    1901  gttcgtgtcc atgtcaaagg atagtttttc actcacccat tggaacacca
    1951  caaagaatgc caaacaatgg atgaaatccg tgggcatctg tggtgaaagg
    2001  attacaggtg ggttaccagt tgtgcaagaa tactacagaa agtatcagga
    2051  aattgctgga gacgtgaagt tctctcattc cctagagata acctcatctg
    2101  gaacgtacag gttagcccag aattcttctc gggcctatgg ttcagttagc
    2151  gagatggcgc gttttagttt cttcctggca tttggagtta tcccagatgc
    2201  tcagattgcc ttggagaaac acataagaga catgcccgtc gcagctgaat
    2251  ttgggcccga tgaaagtctg gcagaccaca caattgaatg gcttctaaag
    2301  tgatcgttcc tgatttgggt agtgataatg agattgacgt gccagtggga
    2351  ggacgtggga atagggggaa acagaagggt aagatatccg tcgcaaagga
    2401  cgctgtctcc aaacggacat ctgatggtgg taatgggggt tcttgggttg
    2451  ttgtggctga gaccgtttcg gtcaatatac acttcaactt ttagcatgcc
    2501  ccctctgata aacctccaac acatattgaa tcttaccttg ttgtccctga
    2551  ttctaagttc tttcatcttg gcagagagag taacgcacaa tcactactca
    2601  aacgacaaca gcaaagcgca atatatacgg atctcaactg ggcaataaca
    2651  tggacgtcta caagaatgac ccaatagtta ggcaggcagt ggcaaaggga
    2701  gtagcttggg cggttaagct gaacactaga gggtggtctt cattgaccac
    2751  ccaacagaag aaagctgcgc gctcagctct gtctgtgata caatccccag
    2801  cggtggttgt acctcgcaga accagagtac gaaacccagt acccgcgggc
    2851  ctgaaatcag ggaatggcaa ggcagggaag agctcaactc taacccgatc
    2901  ggagtttatc tgcaacgtat cgagcacaac cggagtgacc ccgactttcc
    2951  aatcatggat cataaatcct agggaggtca aaagtttccc acaatcttcc
    3001  gtctgctcgg ttggctacaa caagtacagg atcacggact tcaggattag
    3051  gttttctact tcctgttccg acactatgaa tgggaaggtg gccattggct
    3101  tcactcccga ctctagcgat ccggttcctg ttgataagtc acagctgtac
    3151  gggatgcagg tgtatgccga cactccagca aaggagtcgg tcaccttgaa
    3201  aacggctgcg gataatacga tcaggttcct gcgggattca tccagcgatg
    3251  atgccaagct ggtggattat ggccgcgtag ttttagccac atacggtttt
    3301  gatagcacag ctccgtcagt gattggagag ctgttcttcg aatacaccgt
    3351  agtctatctc gaccctacct atgtcgtggc tttaacacaa catggcacgt
    3401  tgaccacctc atctggcccc ccatatgcta ccttgaccac cactgccact
    3451  tcaacatcca tggaattaaa cacccatgga aagtggctag tggtttgggt
    3501  ctcggcagac gaggtgatca actctccggt tatatccggg tccggggcaa
    3551  gcggatccgt aactgtcgtt agcgacgcac agactactgt tgttgcagtg
    3601  gtcaccgcaa acttgccagg cgccatcatt tccaacactt caaccgctgc
    3651  cccttcgtca ctggagtggt acgtatctag gctatgagag ggcagtcacc
    3701  ctaccttctg ccagaggttc ccggaggagt agtgatcctt tgggggtgat
    3751  tcatagctag gaaaggtcgg agagttggga ggaggccaaa tgggggaggt
    3801  gctaggagca ccagaggcag cagagcaaaa atccgggttt catcgcctgg
    3851  tgcgggcgct caatgctgct aacaagttcc agaaggaaga aaggttttgg
    3901  tcgatggaga ccttaacccg ccc