Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus isolate MNSV-Al, complete genome.

ACC No: DQ339157

Dated: 2006-07-19 | Length: 4268 | CRC: -1663112994

                
ID   DQ339157; SV 1; linear; genomic RNA; STD; VRL; 4268 BP.
XX
AC   DQ339157;
XX
DT   02-MAR-2006 (Rel. 87, Created)
DT   19-JUL-2006 (Rel. 88, Last updated, Version 2)
XX
DE   Melon necrotic spot virus isolate MNSV-Al, complete genome.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4268
RA   Genoves A., Navarro J.A., Pallas V.;
RT   "Functional analysis of the five melon necrotic spot virus genome-encoded
RT   proteins";
RL   J. Gen. Virol. 87(8):2371-2380(2006).
XX
RN   [2]
RP   1-4268
RA   Navarro J.A., Pallas V.;
RT   ;
RL   Submitted (21-DEC-2005) to the EMBL/GenBank/DDBJ databases.
RL   Biologia del Estres, Instituto de Biologia Molecular y Celular de Plantas
RL   (UPV-CSIC), Avenida de los Naranjos, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4268
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="MNSV-Al"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain:Almeria"
FT                   /db_xref="taxon:11987"
FT   CDS             89. .2464
FT                   /codon_start=1
FT                   /transl_except=(pos:893. .895,aa:OTHER)
FT                   /product="p89"
FT                   /note="putative RNA-dependent RNA polymerase; produced by a
FT                   readthrough of the amber codon"
FT                   /db_xref="GOA:Q27YA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q27YA5"
FT                   /protein_id="ABC67516.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVAAVVGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDIGEEIVVGTIGIGIHANVNPEGRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLTHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFPQDRPIKTRKLYCLGGVGTSVKFNVHNSSLANLRRGLIERVFFVEND
FT                   KKELEPAPKPLSGAFDRLTWFRRKLHNIVGTHSSISPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRRDAYLKTFVKAEKINTTKKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSSDALKWEHSVY
FT                   LDAFCHDSHLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEIFEQLE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGINHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMMIRNTQSINSSGILRDVSFASGFRELARLGNRKSGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNPRIQPISWTLNEL"
FT   CDS             89. .895
FT                   /codon_start=1
FT                   /product="p29"
FT                   /db_xref="UniProtKB/TrEMBL:Q27YA4"
FT                   /protein_id="ABC67520.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCSKIAKVAAVVGIGYLGVRIGAAWCRRTPGITNSIITYGEEVVEQVKVDIDE
FT                   DAEEESDIGEEIVVGTIGIGIHANVNPEGRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSIAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLTHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2443. .2640
FT                   /codon_start=1
FT                   /product="p7A"
FT                   /note="movement protein"
FT                   /db_xref="GOA:Q8V993"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:Q8V993"
FT                   /protein_id="ABC67517.1"
FT                   /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2644. .2829
FT                   /codon_start=1
FT                   /product="p7B"
FT                   /note="movement protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q27YA2"
FT                   /protein_id="ABC67518.1"
FT                   /translation="MACCRCDSSPGDYSGALLILFISFVFFYITSLSSQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             2816. .3988
FT                   /codon_start=1
FT                   /product="p42"
FT                   /note="coat protein"
FT                   /db_xref="GOA:Q27YA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q27YA1"
FT                   /protein_id="ABC67519.1"
FT                   /translation="MAMVRRINNLPTVKLAKQALPLLANPKIVNKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISYTEGAKPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNVGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDFGQFLFATYSGAGDTAHGDLYVEYAVEFKDPQPIAGMVCTFDRSVSFSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLTFTGNSKLVGNSLNVS
FT                   SSGASALTFTLNSTGVPNSSNSSFSVGTVVALTRVRMTITRCSPETAYLA"
XX
SQ   Sequence 4268 BP; 1063 A; 892 C; 1066 G; 1247 T; 0 other;

dq339157 Length: 4268  19-JUL-2006  Type: N  Check: 5668  ..

       1  ggattactct agccggatcc ccgactctct tattttctgt aagttagttc
      51  gtgtattgat tgtctgtctt gatcagtata ggttagcaat ggatactggt
     101  ttgaaatttc ttgtttctgg gggtttagcc acctcatctg ttatcaggaa
     151  agtgagtgct gtgagttcat tggattcgtc ccttccttca tcatctatat
     201  tatctgccat ccatgggtct tggactagtg ctatcagcca cgattgtagt
     251  aaaattgcca aggttgccgc cgtagttggt attggttatc ttggggtcag
     301  gattggtgcc gcttggtgcc gtcgtactcc cgggataacg aattccataa
     351  tcacctatgg ggaagaagtg gttgagcaag tgaaggtaga tattgatgaa
     401  gatgctgaag aggagtccga tattggtgag gaaattgtgg ttggcacgat
     451  aggcattggt atacacgcaa acgtcaaccc tgagggtcga gctaagcgta
     501  gacatagatc gaggccattc attaagaaga ttgtgaattt aacgaagaat
     551  cacttcggtg ggtgccccga ctctagtaaa tcgaacgtca tggctgtaag
     601  caaattcgtc tatgaacaat gcaaacagca caattgtctt ccacatcaaa
     651  cgagattgat catgagtatt gcagttccat tggtgctaag tcccgatatg
     701  tacgacattt ccagcaaagc tctgttaaac agcgagatat tgacagaaaa
     751  cagagctacg ctggaccgcc tcaaaactct tgatgggtgg ttaacacatt
     801  tggtgtgcca cccccttagc gcgaaggctt ggaggcgggc aattgacaac
     851  ttgtgtggtc ttccagattg gaaggctttc aagttggtca actaggggtg
     901  cctagaggag ctcgctgggt tctgtacttc ggtacggaga gggacacacc
     951  cagacatgac cgagtttcct caggatcgtc ccattaagac acgcaaactg
    1001  tattgtttag ggggagttgg aactagcgtg aagttcaacg tgcataatag
    1051  ctctctagct aaccttcggc gcggtctaat tgagcgcgtt ttctttgttg
    1101  aaaatgataa aaaggaacta gagcctgccc ctaaacctct tagtggtgcg
    1151  tttgatcgct taacttggtt tcgtcggaaa ctccataata ttgtgggtac
    1201  tcattccagt attagtccag gtcaattcct ggacttctat actggcagga
    1251  ggcgcacgat ttatgaaggt gccgtgaaat cgttggaggg gttaagtgtt
    1301  caacgaaggg atgcctatct gaaaacgttt gttaaagcgg agaagatcaa
    1351  taccactaag aagcctgacc cagctccgcg ggttatacaa ccgaggaacg
    1401  taagatataa tgttgaggtt ggtcgttatc tacgaaggtt tgagcattac
    1451  ctctatcgag gaattgacga aatctggaat ggccccacca taataaaagg
    1501  atacactgtc gagcaaattg ggaaaatcgc ccgtgacgct tgggactctt
    1551  tcgttagtcc tgtagcaatc gggtttgaca tgaaaaggtt cgaccaacat
    1601  gtatcctccg atgctcttaa atgggaacat agtgtttatc ttgacgcttt
    1651  ttgccacgac tcacatctcg cagaattgtt agagtggcaa ttagttaata
    1701  agggtgttgg gtatgctagt gatggaatga ttaaatataa ggttgatggg
    1751  tgccggatga gtggtgacat gaatacagct atgggtaact gtttgattgc
    1801  ctgtgctatc acgcatgatt tcttccgtag tcgtggtatc agggcgcgtt
    1851  tgatgaacaa tggtgatgac tgtgtcgtaa tatgtgaaaa agaatgtgcc
    1901  gcggtggtta aagccgacat ggtaaggcac tggagacaat tcgggtttca
    1951  atgcgaactc gagtgcgacg cagaaatctt cgagcaactt gagttttgtc
    2001  aaatgcgacc tgtgtacgac ggggagaaat acgtgatggt gcggaatcct
    2051  ttggttagcc tatctaaaga ttcctactca gtcggccctt ggaatggaat
    2101  caaccatgca cgcaagtggg ttaatgcagt tggcttgtgt ggcttatccc
    2151  tcactggtgg aattcctgtt gtccagagtt attataatat gatgatccgc
    2201  aacacccagt ccataaacag ttctggcata cttcgcgatg tcagctttgc
    2251  tagtggattt cgggagttag cgcgattggg taacaggaaa agtggtgcca
    2301  tatctgaaga cgcccgtttt agcttttatc tcgcatttgg cattactcca
    2351  gatttacaac gtgccatgga aagtgactat gatgctcata ccatagagtg
    2401  gggtttcgtg ccccagggaa atcctagaat acagccaatc tcatggactc
    2451  tcaacgaact gtagaacaaa ctaatcctcg tggaagaagt aaagaacgtg
    2501  gtgacagcgg gggaaaacag aagaactcaa tggggcgaaa gatagccaat
    2551  gatgctatct ctgaatcgaa gcaaggagtt atgggtgcta gcacatacat
    2601  tgctgataaa attaaggtga ctattaactt taacttttag tgtatggctt
    2651  gttgccgttg cgactccagc cccggggatt actctggagc gttgcttata
    2701  ttatttatct catttgtttt cttttatatt acctcgctta gctcgcaagg
    2751  aaatacttac gttcatcact tcgataactc ttccgttaaa acacaatacg
    2801  ttggcatctc tacaaatggc gatggttaga cgcattaata atttacccac
    2851  agtgaagctt gctaagcagg ctctacccct gctagcgaac cctaaaattg
    2901  taaataaagc tatagatgtg gttcctttgg tcgtccaagg tggtcagaaa
    2951  ttgtccaagg ctgctaagcg attgcttggc gcttatggag gcaacatttc
    3001  gtacactgag ggtgccaaac caggcgcaat atcagctcct gtcgctatta
    3051  gtcggcgagt ggctggtatg aagcctaggt ttgttcgatc ggaaggatct
    3101  gtgaagatag ttcataggga gtttattgcc tctgttcttc cttcgaatga
    3151  tctcactgtt aataatggtg atgtcaacgt cggcaagtat agagtcaatc
    3201  ccagtaataa cgctttattc acatggcttc agggacaagc gcaactatat
    3251  gatatgtaca gatttactcg gctccgtttc acctatattc ctactaccgg
    3301  atcgacttcc acgggtcgtg tttctatcct ttgggataga gattctcagg
    3351  accccctccc tattgatcgt gctgccatta gctcttatgc tcattacgct
    3401  gattcagcgc cttgggccga gaatgtccta gtggttcctt gtgataatac
    3451  gtggaggtac atgaatgata ccaatgctgt cgaccggaag ttggttgatt
    3501  ttgggcagtt ccttttcgct acttactctg gtgctggtga caccgcccat
    3551  ggtgatcttt atgtcgagta tgctgtggaa ttcaaggacc cccagcctat
    3601  cgctgggatg gtatgtacgt ttgatcgctc tgtttccttc tctgaagttg
    3651  ggtctactat taagggagtc aattatattg ctgatcgtga tgtgataacc
    3701  actgggggca atattggtgt taacatcaat attcccggga cttatctcgt
    3751  cacgattgtt cttaatgcca catcgattgg ttccctcacc ttcactggta
    3801  attctaaact tgtaggcaac agtcttaacg tttccagcag tggtgcatct
    3851  gctcttacgt tcactcttaa ctccactggt gtgcccaaca gtagtaattc
    3901  ttcattctct gtgggtaccg ttgttgcatt gactagggtg cgtatgacga
    3951  tcactcgctg ctctccagaa acagcctacc tcgcctaatt tgatttattg
    4001  tactccaaat ttggtctccc atattcctac ctgttctcag ccagatctct
    4051  gttctggtgt cctataggca tccttgtcgt gtgtagtgcg gtctggctaa
    4101  ccgtaacggc gtatcggctt ggctttccaa tgattaggct ccgggatgta
    4151  cgacatagct gaagatggat ggagttcggt agaccaccgc tagcaaaata
    4201  cactctgtgt ggggcgtgct agtggatagt catgtatgtt tgagatgggt
    4251  tataggccca tcccgccc