Sequence of DPV Pelargonium flower break virus

Pelargonium flower break virus isolate KN4 clone 1 putative movement protein (p7), putative movement protein (p12), and coat protein (CP) genes, complete cds.

ACC No: DQ443036

Dated: 2006-08-01 | Length: 1828 | CRC: -1592402394

                
ID   DQ443036; SV 1; linear; genomic RNA; STD; VRL; 1828 BP.
XX
AC   DQ443036;
XX
DT   06-APR-2006 (Rel. 87, Created)
DT   01-AUG-2006 (Rel. 88, Last updated, Version 2)
XX
DE   Pelargonium flower break virus isolate KN4 clone 1 putative movement
DE   protein (p7), putative movement protein (p12), and coat protein (CP) genes,
DE   complete cds.
XX
KW   .
XX
OS   Pelargonium flower break virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1828
RX   PUBMED; 16873268.
RA   Rico P., Ivars P., Elena S.F., Hernandez C.;
RT   "Insights into the selective pressures restricting pelargonium flower break
RT   virus genome variability: evidence for host adaptation";
RL   J. Virol. 80(16):8124-8132(2006).
XX
RN   [2]
RP   1-1828
RA   Rico P., Ivars P., Elena S.F., Hernandez C.;
RT   ;
RL   Submitted (06-MAR-2006) to the EMBL/GenBank/DDBJ databases.
RL   Biologia del estres, Instituto de Biologia Molecular y Celular de Plantas,
RL   Avda. de los Naranjos s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1828
FT                   /organism="Pelargonium flower break virus"
FT                   /specific_host="Pelargonium"
FT                   /isolate="KN4"
FT                   /mol_type="genomic RNA"
FT                   /country="Kenya"
FT                   /clone="1"
FT                   /db_xref="taxon:35291"
FT   gene            193. .399
FT                   /gene="p7"
FT   CDS             193. .399
FT                   /codon_start=1
FT                   /gene="p7"
FT                   /product="putative movement protein"
FT                   /db_xref="GOA:Q70WT9"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:Q70WT9"
FT                   /protein_id="ABD93310.1"
FT                   /translation="MASKVIVPDLGSDNEIDVSVGGRGNRGKQKGKISVAKDAVSKRTS
FT                   DGGNGGSWVVVAETVSVNIHFNF"
FT   gene            233. .553
FT                   /gene="p12"
FT   CDS             233. .553
FT                   /codon_start=1
FT                   /gene="p12"
FT                   /product="putative movement protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PGE5"
FT                   /protein_id="ABD93311.1"
FT                   /translation="MRLTCQWEDVGIGENRRVRYPSQRTLSPNGHLMVVMGVLGLLWLR
FT                   PFRSIYTSTFSMPPLINLQHILNLTLLSLILSSFILAERVTHNQYSNDNSKAQYIRIST
FT                   GQ"
FT   gene            555. .1592
FT                   /gene="CP"
FT   CDS             555. .1592
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:Q1PGE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PGE7"
FT                   /protein_id="ABD93312.1"
FT                   /translation="MDAYKNDPTVRQAVAKGVAWAVKLNTRGWSSLTTQQKKAARSALS
FT                   VIQSPAVVVPRRARVRNPVPAGLKSGNGKAGKSSTLTRSEFICNVSSTTGVTPTFQSWI
FT                   INPREVKSFPQSSVCSIGYNKYRITDFRIRFSTSCSDTMNGKVAIGFTPDSSDPVPVDK
FT                   SQLYGMQVYADTPAKESVTLKTAADNTIRFLRDSSSDDAKLVDYGRVVLATYGFDSTAP
FT                   SVIGELFFEYTVVYLDPTYVVALTQHGTLTASSGPPYATLTTTATSTSMELNTHGKWLV
FT                   VWVSADEVINSPVISGSGASGSVTVVSDAQTTVVAVVTANLPGAIISNTSTAAPSSLEW
FT                   YVSRL"
XX
SQ   Sequence 1828 BP; 464 A; 444 C; 486 G; 434 T; 0 other;

dq443036 Length: 1828  01-AUG-2006  Type: N  Check: 186  ..

       1  atcaggaacg tacaggttag cccagaattc ttctcgggcc tatggttcag
      51  ttagcgagat ggcgcgtttt agtttcttcc tggcatttgg agttatccca
     101  gatgctcaga ttgccttgga gaaacacata agagacatgc ccgtcgcagc
     151  tgaatttggg cccgatgaaa gtctggcaga ccacacaatt gaatggcttc
     201  taaagtgatc gttcctgatt tgggtagtga taatgagatt gacgtgtcag
     251  tgggaggacg tgggaatagg ggaaaacaga agggtaagat atccgtcgca
     301  aaggacgctg tctccaaacg gacatctgat ggtggtaatg ggggttcttg
     351  ggttgttgtg gctgagaccg tttcggtcaa tatacacttc aacttttagc
     401  atgccccctc tgataaacct ccaacacata ctgaatctta ctttgttgtc
     451  cctgattcta agttctttca tcttggcaga gagagtaacg cacaatcagt
     501  actcaaacga caacagcaaa gcgcaatata tacggatctc aactgggcaa
     551  taacatggac gcctacaaga atgacccaac agttaggcag gcagtggcaa
     601  agggagtagc gtgggcggtt aagctgaaca ctagagggtg gtcttcgttg
     651  accacccaac agaagaaagc tgcgcgctca gctctgtctg tgatacaatc
     701  cccagcggtg gttgtacctc gcagagccag agtacgaaac ccagtacccg
     751  cgggcctgaa atcagggaat ggcaaggcag ggaaaagctc aactctaacc
     801  cgatcggagt ttatctgcaa cgtatcgagc acaaccgggg tgaccccgac
     851  tttccaatca tggattataa atcctaggga ggtcaaaagt ttcccacaat
     901  cttccgtctg ctcgattggc tacaacaagt acaggattac ggacttcagg
     951  attaggtttt ctacttcctg ttccgacact atgaatggga aggtggccat
    1001  tggcttcact cccgactcta gcgatccggt ccctgttgat aagtcacagc
    1051  tgtacggaat gcaggtgtat gccgacactc cagcaaagga gtcggtcacc
    1101  ttgaagacgg ctgcagataa cacgattagg ttcctgcggg attcatccag
    1151  cgatgatgcc aagctggtgg attatggccg cgtagtttta gccacatacg
    1201  gtttcgatag cacagctcca tcagtaatag gagagctgtt cttcgagtac
    1251  accgtagttt atctcgaccc tacctatgtc gtggctttaa cacaacatgg
    1301  cacgttgacc gcctcatctg gccccccata tgctaccttg accaccactg
    1351  ccacttcaac atccatggaa ttaaacaccc atggaaagtg gctagtggtt
    1401  tgggtctcgg cagacgaggt gatcaactct ccggttatat ccgggtccgg
    1451  ggcaagcgga tccgtaactg tcgttagcga cgcacagact actgttgttg
    1501  cagtggttac cgcaaacttg ccaggcgcca tcatttccaa cacttcaacc
    1551  gctgcccctt cgtcactgga gtggtacgta tctaggctat gagagggcag
    1601  tcaccctacc ttctgccaga ggttcccgga ggagtagtga tcctttgggg
    1651  gtgattcata gctaggaaag gtcggagagt tggaaggagg ccaactgggg
    1701  gaggtgctag gagcaccaga ggcagtagag caaaaatccg ggtttcatcg
    1751  cctggtgcgg gcgctcaatg ctgctaacaa gttcctgaag gaagaaaggt
    1801  tttggtcgat ggagacctta acccgccc