Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus isolate MNSV-ISR from Israel, complete genome.

ACC No: DQ922807

Dated: 2006-10-19 | Length: 4266 | CRC: 121340436

                
ID   DQ922807; SV 1; linear; genomic RNA; STD; VRL; 4266 BP.
XX
AC   DQ922807;
XX
DT   19-OCT-2006 (Rel. 89, Created)
DT   19-OCT-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Melon necrotic spot virus isolate MNSV-ISR from Israel, complete genome.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4266
RA   Barkan G., Hadas R., Leibman D., Gal-On A.;
RT   "Characterization of MNSV isolate infected melon in Israel";
RL   Unpublished.
XX
RN   [2]
RP   1-4266
RA   Barkan G., Hadas R., Leibman D., Gal-On A.;
RT   ;
RL   Submitted (17-AUG-2006) to the EMBL/GenBank/DDBJ databases.
RL   Virology, Volcani Center A.R.O, P.O. BOX 6, Bet-Dagan 50250, Israel
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4266
FT                   /organism="Melon necrotic spot virus"
FT                   /isolate="MNSV-ISR"
FT                   /mol_type="genomic RNA"
FT                   /country="Israel"
FT                   /db_xref="taxon:11987"
FT   CDS             88. .2463
FT                   /codon_start=1
FT                   /transl_except=(pos:892. .894,aa:OTHER)
FT                   /product="putative RNA-dependent RNA polymerase"
FT                   /note="produced by a readthrough of the amber codon;
FT                   replicase; 89K protein"
FT                   /protein_id="ABJ53276.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCCKIAKVATIVGIGYLGVRIGAAWCRRTPGIINSIITYGEEVVEQVKVDIDE
FT                   DAEEESDIGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLTHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVNXGCLEELAGFCTS
FT                   VRRGTHPDMTEFSQDRPIKTRKLYCLGGVGTSVKFNVHNNSLANLRRGLIERVFFVEND
FT                   RKELEPAPKPLSGAFDRLTWFRRKLHNIVGTHSSISPGQFLDFYTGRRRTIYEGAVKSL
FT                   EGLSVQRRDAYLKTFVKAEKINTTKKPDPAPRVIQPRNVRYNVEVGRYLRRFEHYLYRG
FT                   IDEIWNGPTIIKGYTVEQIGKIARDAWDSFVSPVAIGFDMKRFDQHVSSDALKWEHSVY
FT                   LDAFCHDSYLAELLEWQLVNKGVGYASDGMIKYKVDGCRMSGDMNTAMGNCLIACAITH
FT                   DFFRSRGIRARLMNNGDDCVVICEKECAAVVKADMVRHWRQFGFQCELECDAEIFEQIE
FT                   FCQMRPVYDGEKYVMVRNPLVSLSKDSYSVGPWNGINHARKWVNAVGLCGLSLTGGIPV
FT                   VQSYYNMTIRNTQSVNSSGILRDVSFASGFRELARLGNRKCGAISEDARFSFYLAFGIT
FT                   PDLQRAMESDYDAHTIEWGFVPQGNPRIQPISWTLNEL"
FT   CDS             88. .894
FT                   /codon_start=1
FT                   /product="29K protein"
FT                   /protein_id="ABJ53277.1"
FT                   /translation="MDTGLKFLVSGGLATSSVIRKVSAVSSLDSSLPSSSILSAIHGSW
FT                   TSAISHDCCKIAKVATIVGIGYLGVRIGAAWCRRTPGIINSIITYGEEVVEQVKVDIDE
FT                   DAEEESDIGEEIVVGTIGIGIHTNVNPEVRAKRRHRSRPFIKKIVNLTKNHFGGCPDSS
FT                   KSNVMAVSKFVYEQCKQHNCLPHQTRLIMSVAVPLVLSPDMYDISSKALLNSEILTENR
FT                   ATLDRLKTLDGWLTHLVCHPLSAKAWRRAIDNLCGLPDWKAFKLVN"
FT   CDS             2442. .2828
FT                   /codon_start=1
FT                   /transl_except=(pos:2637. .2639,aa:OTHER)
FT                   /product="14K protein"
FT                   /note="produced by a readthrough of the amber codon"
FT                   /protein_id="ABJ53281.1"
FT                   /translation="MDPQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNFXCMACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGN
FT                   TYVHHFDNSSVKTQYVGISTNGDG"
FT   CDS             2442. .2639
FT                   /codon_start=1
FT                   /product="p7A protein"
FT                   /protein_id="ABJ53279.1"
FT                   /translation="MDPQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             2643. .2828
FT                   /codon_start=1
FT                   /product="p7B protein"
FT                   /protein_id="ABJ53280.1"
FT                   /translation="MACYRCDSSPGDYSGALLILFISFVFFYITSLSPQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             2815. .3987
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="42K protein"
FT                   /protein_id="ABJ53278.1"
FT                   /translation="MAMVRRINNLPTVKLAKQALPLLTNPKIANKAIDVVPLVVQGGQK
FT                   LSKAAKRLLGAYGGNISFTEGARPGAISAPVAISRRVAGMKPRFVRSEGSVKIVHREFI
FT                   ASVLPSNDLTVNNGDVNVGKYRVNPSNNALFTWLQGQAQLYDMYRFTRLRFTYIPTTGS
FT                   TSTGRVSILWDRDSQDPLPIDRAAISSYAHYADSAPWAENVLVVPCDNTWRYMNDTNAV
FT                   DRKLVDIGQFLFATYSGAGNTAHGDLYVEYAVEFKDPQPIAGMVCMFDRSVSSSEVGST
FT                   IKGVNYIADRDVITTGGNIGVNINIPGTYLVTIVLNATSIGSLIFAGNSKLVGNSLNVS
FT                   SSGASVLTFTLNSSGVPNSSDSSFSVGTVVALTRVRVTITRCSPETAYLA"
XX
SQ   Sequence 4266 BP; 1083 A; 890 C; 1048 G; 1245 T; 0 other;

dq922807 Length: 4266  19-OCT-2006  Type: N  Check: 1846  ..

       1  ggattactct agccggatcc ccgactctct tatttttgta agttagttcg
      51  tatattgatt atctatcttg atcaatatag gttagcaatg gatactggtt
     101  tgaaatttct tgtttctgga ggtttagcca cctcatctgt tatcaggaaa
     151  gtgagtgctg tgagttcatt ggattcgtcc cttccttcat catctatatt
     201  atctgccatc catgggtctt ggactagtgc tatcagccac gattgttgta
     251  aaatcgccaa ggttgccacc atagttggta ttggttatct tggggttagg
     301  attggtgccg cttggtgccg tcgtactccc gggataataa attccataat
     351  cacctatggg gaagaagtgg ttgagcaagt gaaggtggat attgatgaag
     401  atgctgaaga ggagtccgat attggtgagg aaattgtggt tggtacgata
     451  ggtattggta tacacacgaa cgtcaaccca gaagttcgag ctaagcgcag
     501  acatagatcg aggccattca ttaagaagat tgtgaattta acgaagaatc
     551  acttcggtgg gtgccccgac tccagcaaat cgaacgtcat ggctgtaagc
     601  aaattcgttt atgaacaatg caagcagcac aattgtcttc cacatcaaac
     651  gagattgatc atgagtgttg cagttccatt ggtgctaagt cccgatatgt
     701  acgacatttc cagcaaagct ctgctaaaca gcgagatatt gacagaaaac
     751  agagctacgc tggaccgcct caaaactctt gatgggtggt tgacacattt
     801  ggtgtgccat ccccttagcg cgaaggcttg gaggcgggca attgacaact
     851  tgtgtggtct tccagattgg aaggctttca agttggtcaa ctaggggtgc
     901  ctagaggaac tcgctgggtt ctgtacttcg gtacggagag ggacacaccc
     951  agacatgacc gagttttctc aggatcgtcc tattaagaca cgcaaactgt
    1001  attgtttagg gggagttgga actagcgtga agttcaatgt gcacaataac
    1051  tccctagcta accttcggcg cggtctaatt gaacgcgttt tctttgttga
    1101  aaatgatagg aaggaactag agcctgcccc taaacctctt agtggtgctt
    1151  ttgatcgctt aacttggttt cgtcggaaac ttcataatat tgtgggtact
    1201  cattccagta ttagtccagg tcaattcttg gacttctata ctggcaggag
    1251  gcgcacgatc tatgaaggtg ctgtgaaatc attggagggg ttaagtgttc
    1301  aacgaaggga tgcctatctg aaaacgtttg ttaaggcgga gaagattaac
    1351  accactaaga agcctgaccc agctccgcgg gtcatacaac cgaggaacgt
    1401  aagatataat gttgaggttg gtcgttatct acgtaggttt gagcattacc
    1451  tctatcgagg aattgacgaa atctggaatg gccccactat aataaaagga
    1501  tacactgtcg agcaaattgg gaaaatcgcc cgtgacgctt gggactcatt
    1551  cgttagtcct gtagcaatcg ggtttgatat gaaaaggttc gaccaacatg
    1601  tatcctccga tgctcttaaa tgggaacata gtgtttatct tgatgctttt
    1651  tgccacgact catatctcgc agaattgtta gagtggcaat tagtcaataa
    1701  gggtgtcggg tatgctagtg atggaatgat taaatataag gttgatgggt
    1751  gccggatgag cggtgacatg aatacagcta tgggtaactg tttgatcgcc
    1801  tgtgctatta cgcatgattt cttccgtagt cgtggtatca gagcgcgttt
    1851  gatgaacaat ggtgatgact gtgtcgtaat atgtgaaaaa gaatgtgccg
    1901  cggtggttaa agccgacatg gtaaggcact ggagacaatt cgggtttcaa
    1951  tgcgaactcg agtgcgacgc agaaattttc gagcagattg aattttgtca
    2001  aatgcggcct gtgtacgacg gggagaaata tgtgatggtg cggaatcctt
    2051  tggttagcct atctaaagat tcctactcag tcggcccttg gaatggaatc
    2101  aaccatgcac gcaagtgggt caacgcagtt ggcttgtgtg gcttatccct
    2151  cactggtgga attcctgttg tccagagtta ttataacatg acgatccgca
    2201  acacccaatc cgtaaatagt tctggcatac tacgcgatgt cagtttcgct
    2251  agcggatttc gggaattagc gcgattgggt aacaggaaat gtggtgccat
    2301  atcagaagac gcccgtttta gcttttatct cgcatttggc attactccag
    2351  atttacaacg tgccatggaa agtgactatg atgctcatac tatagagtgg
    2401  ggttttgtac cccagggaaa tcctagaata cagccaatct catggaccct
    2451  caacgaactg tagaacaaac taatcctcgt ggaagaagta aagaacgtgg
    2501  tgatagcggg ggaaaacaga agaactcaat ggggcgaaag atagccaatg
    2551  atgctatctc tgaatcgaag caaggagtta tgggtgctag tacatacatt
    2601  gctgataaaa ttaaggtgac tatcaacttt aatttttagt gtatggcttg
    2651  ctaccgttgc gactccagcc ccggggatta ctccggagca ttgcttatat
    2701  tatttatctc atttgttttc ttttatatta cctcgcttag cccgcaagga
    2751  aatacttacg ttcatcactt cgataattct tccgttaaaa cacaatacgt
    2801  tggcatctct acaaatggcg atggttagac gcattaataa tttacccaca
    2851  gtgaagcttg ctaagcaggc tctacccctg ctaacgaatc ctaaaattgc
    2901  aaataaagct atagatgtgg ttcctctggt cgtccaaggt ggtcagaaat
    2951  tgtccaaggc tgctaagcga ttgctcggcg cttatggagg taatatttcg
    3001  ttcactgagg gtgccagacc aggcgcaata tcagctcctg tcgctattag
    3051  tcggcgagtg gctggcatga agcctaggtt cgtccgatca gaaggatctg
    3101  tgaagatagt tcacagggag tttattgctt ctgttcttcc ttcgaatgat
    3151  ctcactgtta ataacggtga tgtcaacgtt ggtaagtaca gggtcaatcc
    3201  cagtaataac gctttattta catggcttca gggacaagca caactatatg
    3251  atatgtacag atttactcgg ctccgtttca cctacattcc tactaccgga
    3301  tcaacttcta cgggtcgtgt ctctatcctt tgggatagag attctcagga
    3351  ccccctcccc attgatcgtg cagccattag ctcttatgct cattacgctg
    3401  attcagcgcc ttgggctgag aatgttctag tggttccttg tgacaatacg
    3451  tggaggtaca tgaatgatac caatgccgtc gaccggaagt tggttgatat
    3501  tgggcagttc cttttcgcta cttattctgg tgctggtaac accgcccatg
    3551  gtgatcttta cgtcgagtat gctgtagaat ttaaggaccc ccagcctatc
    3601  gctggtatgg tatgcatgtt tgatcgctct gtctcttcct ctgaagttgg
    3651  atccactatt aagggagtca attatattgc tgatcgtgat gtgataacca
    3701  ctggaggcaa tattggtgtt aacatcaata ttcccgggac ctatctcgtc
    3751  acgattgttc ttaatgccac atcgattggt tccctcatct tcgctggtaa
    3801  ttctaaactt gtaggcaaca gtcttaatgt ttccagcagt ggtgcatctg
    3851  ttcttacgtt tacccttaat tcctctggtg tgcccaacag tagtgattct
    3901  tcattctctg tgggtaccgt tgttgcattg actagggtgc gcgtaacaat
    3951  cactcgctgc tctccagaaa ctgcctacct cgcctaattc gattaatgta
    4001  ctccaaaaat tggcctccct tattcctacc cgttctcagc cagatctctg
    4051  ttctggtgtc ctacaggcgt tcatgtcgtg tgtagtgcgg tctggctaac
    4101  cgtaacggcg tatcggcttg gatttccaat gattaggctc caggatgtac
    4151  gacatagttg aagatggatg gagtttggta gaccaccgct agcaaaatac
    4201  actctgtgtg gggcgtgcta gtggatagtc atgtatgtct gagatgggtt
    4251  ataggccatc ccgccc