Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate ITALY-ca3 coat protein gene, partial cds.

ACC No: EF622208

Dated: 2008-01-01 | Length: 1044 | CRC: -1004104003

                
ID   EF622208; SV 1; linear; genomic RNA; STD; VRL; 1044 BP.
XX
AC   EF622208;
XX
DT   01-JAN-2008 (Rel. 94, Created)
DT   01-JAN-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate ITALY-ca3 coat protein gene, partial cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1044
RA   Huang C.H., Chen C.C., Chen L.W., Chiang F.L., Cheng Y.H., Chang C.A.;
RT   "Nucleotide sequence of the coat protein region of Carnation mottle virus
RT   infecting carnation";
RL   Unpublished.
XX
RN   [2]
RP   1-1044
RA   Huang C.H., Chen C.C., Chen L.W., Chiang F.L., Cheng Y.H., Chang C.A.;
RT   ;
RL   Submitted (22-MAY-2007) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, Taiwan Agriculture Research, 189 Chung-Cheng Road, Wu
RL   Feng, Taichung 41301, Taiwan ROC
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1044
FT                   /organism="Carnation mottle virus"
FT                   /specific_host="carnation"
FT                   /isolate="ITALY-ca3"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="tissue imported from Italy"
FT                   /db_xref="taxon:11986"
FT   CDS             1. .>1044
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABU96115.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLCTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILNITKTSAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1044 BP; 303 A; 249 C; 276 G; 216 T; 0 other;

ef622208 Length: 1044  01-JAN-2008  Type: N  Check: 2516  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaaacatt
      51  ggcgcagaag ggggataagt tagccgtgaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgctggatac
     151  actccagcga tcctagcctt cacaccccga cgaccacgga tgacaaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaacta ctatgcaccg tcaaaggtac cacaggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccgtttt
     351  ccctcaactc tcgttgctgg cgaccaactt caacaagtac cgcatcactg
     401  cgcttactgt gaagtactca ccagcatgta gcttcgagac caatgggagg
     451  gtggctctag gattcaacga tgacgcttcg gacacaccgc caaccaccaa
     501  ggttgggttc tacgatctgg gcaaacatgt ggaaactgct gcacaaacag
     551  ccaaagatct agtgatacca gtagacggca agacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttggacgaa tagtcttgtc
     651  aacatacggg tttgacaagg cggacactgt ggtgggcgaa ttgtttatac
     701  agtacacaat cgtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggatggacca acgtatgtgg tcccttcggt
     801  caatggcaac gagctacagc taagagtggt agccgctggg aaatggtgca
     851  ttatagtgcg gggtacggtt gaaggtggct tcaccaaacc cacacttatt
     901  gggccaggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgag ttggtgacac aaatggaggg ccaaatattg aatatcacca
    1001  agacctcagc agaacaacca ctccaatggg ttgtttatag gatg