Sequence of DPV Carnation mottle virus

Carnation mottle virus isolate Netherland-ca3 coat protein gene, partial cds.

ACC No: EF622211

Dated: 2008-01-01 | Length: 1044 | CRC: 555240958

                
ID   EF622211; SV 1; linear; genomic RNA; STD; VRL; 1044 BP.
XX
AC   EF622211;
XX
DT   01-JAN-2008 (Rel. 94, Created)
DT   01-JAN-2008 (Rel. 94, Last updated, Version 1)
XX
DE   Carnation mottle virus isolate Netherland-ca3 coat protein gene, partial
DE   cds.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1044
RA   Huang C.H., Chen C.C., Chen L.W., Chiang F.L., Cheng Y.H., Chang C.A.;
RT   "Nucleotide sequence of the coat protein region of Carnation mottle virus
RT   infecting carnation";
RL   Unpublished.
XX
RN   [2]
RP   1-1044
RA   Huang C.H., Chen C.C., Chen L.W., Chiang F.L., Cheng Y.H., Chang C.A.;
RT   ;
RL   Submitted (22-MAY-2007) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, Taiwan Agriculture Research, 189 Chung-Cheng Road, Wu
RL   Feng, Taichung 41301, Taiwan ROC
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1044
FT                   /organism="Carnation mottle virus"
FT                   /specific_host="carnation"
FT                   /isolate="Netherland-ca3"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="tissue imported from the Netherlands"
FT                   /db_xref="taxon:11986"
FT   CDS             1. .>1044
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ABU96118.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDKLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAILAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAIFPQLSLLAMNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KANTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAICELVTQMEGQILKITKTAAEQP
FT                   LQWVVYRM"
XX
SQ   Sequence 1044 BP; 304 A; 252 C; 278 G; 209 T; 1 other;

ef622211 Length: 1044  01-JAN-2008  Type: N  Check: 1421  ..

       1  atggaaaata aaggagaaaa gatcgcgatg aatcccactg tgcaaacatt
      51  ggcgcagaag ggggacaagt tagccgtgaa gttggtgaca agagggtggg
     101  cctctctgag tacgaaccag aagaggagag ctgaaatgct tgctggatac
     151  actccagcga tcctagcctt cacaccccga cgaccacgga tgacgaaccc
     201  tcctccaaga accagtagga attcaccagg acaagctgga aagtccatga
     251  cgatgagtaa gaccgaacta ctaagcaccg tcaaaggtac cacgggtgtt
     301  atcccaagct ttgaagactg ggtcgtttcc ccccgaaacg tagccatctt
     351  cccccaactc tcgctgctgg cgatgaactt caacaagtac cgcatcactg
     401  cgctcactgt gaagtattca cccgcgtgca gcttcgagac taatgggagg
     451  gtggctctgg gattcaacga tgacgcttcg gacacaccac caaccaccaa
     501  ggttggattt tacgatctgg gcaaacatgt ggaaactgct gcacagacag
     551  ccaaagatct agtgatacca gtagacggca aaacccggtt catcagggac
     601  tcggctagtg atgatgccaa actagtcgat tttggacgaa tagtcttgtc
     651  aacatacggg tttgacaagg ctaacactgt ggtgggcgaa ttattcatac
     701  agtacacgat cgtgctgagt gacccaacca agacggccaa aatttcacag
     751  gcaagcaacg ataaggtgtc ggacggacca acgtatgtgg tcccttcggt
     801  taatggcaac gagctacaac taagagtggt agccgctggg aaatggtgca
     851  ttatagtgcg gggcacggtt gagggaggct tcacmaaacc cacacttatt
     901  gggccgggaa tcagcggtga tgtggactat gaaagtgcca gacctatcgc
     951  catttgtgaa ttggtgacac aaatggaggg ccagatattg aaaatcacca
    1001  agaccgcagc agaacaacca ctccaatggg ttgtttatag gatg