Sequence of DPV Cocksfoot mild mosaic virus

Cocksfoot mild mosaic virus isolate Scotland, complete genome.

ACC No: EU081018

Dated: 2009-09-22 | Length: 4198 | CRC: 1887809518

                
ID   EU081018; SV 1; linear; genomic RNA; STD; VRL; 4198 BP.
XX
AC   EU081018;
XX
DT   02-AUG-2008 (Rel. 96, Created)
DT   22-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Cocksfoot mild mosaic virus isolate Scotland, complete genome.
XX
KW   .
XX
OS   Cocksfoot mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Sobemovirus.
XX
RN   [1]
RP   1-4198
RX   PUBMED; 19693646.
RA   Ziegler A., Cowan G., Torrance L.;
RT   "Comparative sequence analysis and serological and infectivity studies
RT   indicate that cocksfoot mild mosaic virus is a member of the genus
RT   Panicovirus";
RL   Arch. Virol. 154(9):1545-1549(2009).
XX
RN   [2]
RP   1-4198
RA   Ziegler A., Cowan G.H., Torrance L.;
RT   ;
RL   Submitted (03-AUG-2007) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, Scottish Crop Research Institute, Invergowrie, Dundee,
RL   Scotland DD2 5DA, UK
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4198
FT                   /organism="Cocksfoot mild mosaic virus"
FT                   /host="Phleum pratense (timothy grass)"
FT                   /isolate="Scotland"
FT                   /mol_type="genomic RNA"
FT                   /country="United Kingdom:Scotland"
FT                   /db_xref="taxon:479060"
FT   CDS             100. .2904
FT                   /codon_start=1
FT                   /transl_except=(pos:1186. .1188,aa:OTHER)
FT                   /product="p106"
FT                   /note="polymerase readthrough"
FT                   /db_xref="GOA:B4XRZ5"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:B4XRZ5"
FT                   /protein_id="ABW74550.1"
FT                   /translation="MEFFSSALTRLDSTKAATLDWSKFHALFHLCPRAAYAWLKIQLGS
FT                   SILGDLVSFLSRAARALCYLPVAVQEIARSLCERYNAASARAGDAFFYSRLFDTARANR
FT                   WSYLDDSSPPDMGASTVSWVTKVDPLRLPRRALSTVGAGLALYGGYRTLKFLWNMWKFQ
FT                   RRQDAIHSAKTRTQFLEKEYQEVRACMEEMGRAALRTRMEDCILKDVITPEEKDEEGNV
FT                   VQKEVSQMIIKLYGKFVRQLVALAKVEFNGVPKNTEANQLAVWRFMYRCCEKRGLNALD
FT                   ANRALSSALPLVFLPSTYDHNMAITMTCEDTVQTLQRYRDAFAQKSSLHRLLDNPLSGQ
FT                   AWKEWANTILYGDQATGLHFAKXGGIEKWQGVQCKRTRVRHPRLRCHFKDTDHKVSHIH
FT                   RVAGMGDQYTFGLFNNSAGNLERGLAERVFCVKNPQCVHGLDDEFIPTPQPIPGHFRRL
FT                   NKYRKDIIRHVGRKGPIYYEKFLAYYTGPKLVTYSKAVDSLSEMAVRKEDARLKTFVKA
FT                   EKLNLTLKPDPCPRVIQPRDPRYNVEMGRYLKHIEHPIYAAIDKMFGGKTIFKGMSVEA
FT                   MGHEIHKKMRQFPRPCAIGFDASRFDQHVSVEALRYEHSIYKKIHGYPELLNLLCEWQI
FT                   HNDGTAYAKDGFFKYSVNGCRMNTSLGNCILAALISKDLIDRLGITAALVNNGDDNVLI
FT                   CSVDDEAVVVEHLYSHFLDYGFEVVAEAPKYITEQVEFCQMQPVFDGTQYIMVRNPAVS
FT                   MSKDSHSITPFYTPNTMKKWIRAVGECGLSLTGGIPIKQSYYKCFIRNGADKGKIHTSR
FT                   EFASGFQALSKLSTRKERDISTQSRYSFYLAFGYTPDEQVAMENYFDKLVIDPNFSDSG
FT                   SPARASECLLLQLIPKQPTTHSHKRPNKIAKQPAPQDSTWEPVSLAEVQTLLPLGTTPH
FT                   LQAS"
FT   CDS             100. .1188
FT                   /codon_start=1
FT                   /product="p41"
FT                   /note="polymerase"
FT                   /db_xref="UniProtKB/TrEMBL:B4XRZ6"
FT                   /protein_id="ABW74549.1"
FT                   /translation="MEFFSSALTRLDSTKAATLDWSKFHALFHLCPRAAYAWLKIQLGS
FT                   SILGDLVSFLSRAARALCYLPVAVQEIARSLCERYNAASARAGDAFFYSRLFDTARANR
FT                   WSYLDDSSPPDMGASTVSWVTKVDPLRLPRRALSTVGAGLALYGGYRTLKFLWNMWKFQ
FT                   RRQDAIHSAKTRTQFLEKEYQEVRACMEEMGRAALRTRMEDCILKDVITPEEKDEEGNV
FT                   VQKEVSQMIIKLYGKFVRQLVALAKVEFNGVPKNTEANQLAVWRFMYRCCEKRGLNALD
FT                   ANRALSSALPLVFLPSTYDHNMAITMTCEDTVQTLQRYRDAFAQKSSLHRLLDNPLSGQ
FT                   AWKEWANTILYGDQATGLHFAK"
FT   CDS             2733. .2951
FT                   /codon_start=1
FT                   /product="p8"
FT                   /note="possible movement protein"
FT                   /db_xref="GOA:B4XRZ7"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:B4XRZ7"
FT                   /protein_id="ABW74551.1"
FT                   /translation="MSTPPTNPQTADDTLAQAPKQDRQATRAARLNVGAGIARRSADAA
FT                   ATRDDTASASFVIIAERVDVTNNFNFG"
FT   CDS             2954. .3136
FT                   /codon_start=1
FT                   /product="p6.8"
FT                   /note="possible movement protein"
FT                   /db_xref="UniProtKB/TrEMBL:B4XRZ8"
FT                   /protein_id="ABW74552.1"
FT                   /translation="MATGTCHCPDNPFVWPLVTVVLILLIIIVASVTSTGPVIIPPSHN
FT                   TTYHHEKYQNIEVQK"
FT   CDS             3133. .3870
FT                   /codon_start=1
FT                   /product="p26"
FT                   /note="coat protein"
FT                   /db_xref="GOA:B4XRZ9"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:B4XRZ9"
FT                   /protein_id="ABW74553.1"
FT                   /translation="MNGGNTSNRRGRGKALQRRTNKPPRSRSIERARPLAYGQAVGPSP
FT                   PRTVAYRRGRQVNTQPEIILRITAKTTDNYTTVPIIPALLFDPSTQPGYGGRAQYMAGL
FT                   SQLHSQHEWRRLQFTWIPSCATVTPGNVVLKFFPNYRTPLPTVLEDLMDTSSLTFSPYE
FT                   KHTFSVAGRISGLKYNIGATAFLALSDEDKGDYSIGRLVIGTTSQVSAVSLGIIQMVPD
FT                   VEFSGPVTTPVAPTPAATAAAPA"
FT   CDS             3137. .3535
FT                   /codon_start=1
FT                   /product="p15"
FT                   /note="unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:B4XS00"
FT                   /protein_id="ABW74554.1"
FT                   /translation="MEAIPLTEGDVARHYKDGLISLLEVGPSSVLAHWPMAKLWARHPP
FT                   GQWLIDEAGRSIPSRKSYFASLPRRPITTRLCPSYLRSCSTPAHNLDMGDELSIWPVYL
FT                   SSTLNMSGGGCSSPGYPAVPRLHREMWF"
XX
SQ   Sequence 4198 BP; 1086 A; 1185 C; 1053 G; 874 T; 0 other;

eu081018 Length: 4198  22-SEP-2009  Type: N  Check: 8474  ..

       1  gggaactcgg caaaattccc gttcgcgtac aacacgcgtg ctcgcggcag
      51  gcactcaact tgtgcatcag cggcgctaaa cgtacacagc gtattgccca
     101  tggaattctt ctcctccgcc ctcaccaggc tcgacagtac caaggcggca
     151  accttggact ggtccaaatt ccatgccctc ttccacctct gcccccgtgc
     201  tgcttacgct tggctcaaaa tccaactcgg gtcgtcaatc cttggcgact
     251  tggtgtcttt cttgtctcga gctgcacgcg ccctctgcta cctacctgtg
     301  gcggttcaag aaatagcccg gtctctatgc gagagataca acgccgccag
     351  tgctcgcgct ggggacgcgt tcttctacag ccggctgttc gacactgcta
     401  gagccaacag gtggagctac ctagacgaca gtagtccccc cgacatgggc
     451  gcctctactg tgtcctgggt caccaaggtg gaccctctga gattgccgcg
     501  tcgggcgctc tcaacggtcg gagctgggct agccctttac gggggctaca
     551  gaacgctcaa gttcctgtgg aacatgtgga agttccagag aagacaggat
     601  gccatccact cggcaaagac ccgcacccaa ttcctggaaa aggaatacca
     651  ggaggtccgg gcgtgcatgg aagaaatggg gcgcgctgcc ctacgtaccc
     701  ggatggaaga ctgcatcctt aaagacgtca tcactcctga ggaaaaagac
     751  gaagaaggga acgtggtaca aaaggaggta tcgcagatga taatcaagct
     801  ctacggcaag tttgtgaggc aactcgtcgc cctcgcaaag gttgaattca
     851  acggtgttcc aaagaacaca gaagccaacc aacttgcagt ctggaggttc
     901  atgtacagat gctgcgagaa gagggggcta aacgccttag acgcgaacag
     951  ggccctttcc agcgccctgc cgcttgtatt cctcccctcg acctacgacc
    1001  acaacatggc cataacgatg acgtgcgaag acactgtgca gaccctgcaa
    1051  agatataggg acgcattcgc acagaaaagt agcctccaca ggctactcga
    1101  caaccctctc tctgggcagg catggaaaga atgggctaac accattctat
    1151  atggagacca ggcaactggt ctccatttcg ccaaataggg gggtatcgaa
    1201  aagtggcagg gggtgcagtg taaacgtaca cgcgtccggc accccagact
    1251  cagatgccac tttaaagata cggaccacaa agttagccac atacacaggg
    1301  ttgccgggat gggcgaccag tacacttttg ggctcttcaa caacagtgcg
    1351  gggaacttag agcgtgggct cgcagaacgg gtattttgcg tcaagaatcc
    1401  gcaatgtgta cacggattgg acgatgaatt cataccaacc ccacaaccca
    1451  tcccggggca cttccgtcgc ctcaacaagt accgcaaaga tattataaga
    1501  cacgtcggcc gcaagggccc catttactat gagaagttcc tggcttacta
    1551  cactggcccc aagctggtga cttatagtaa ggctgttgat tccctctcgg
    1601  aaatggccgt ccggaaagaa gacgctcgtc tgaaaacctt tgttaaagcg
    1651  gaaaaactca acctcaccct taagcctgac ccctgccccc gcgttatcca
    1701  accgcgcgac ccgcgctaca atgtggaaat gggtaggtac ctcaagcaca
    1751  ttgaacatcc catctacgca gccattgaca agatgtttgg tgggaaaacc
    1801  atatttaagg gtatgagcgt ggaagctatg ggacacgaga tccacaagaa
    1851  aatgcgccaa tttccaagac catgcgcaat tggattcgat gcttccagat
    1901  ttgaccaaca cgtttctgtt gaagcactcc ggtatgagca ctcaatatac
    1951  aagaaaatac acggatatcc tgaactgttg aaccttctct gtgaatggca
    2001  gatccacaac gatggaactg cctatgcaaa agatggcttc ttcaaatact
    2051  ccgtgaatgg ttgtagaatg aacacgtccc tcgggaattg tattctggca
    2101  gctttgatct caaaggattt gattgatcgg cttggtatca cggccgccct
    2151  agtcaacaac ggtgacgaca atgtgctaat ctgctcggtg gatgatgagg
    2201  cagtggtagt ggagcacttg tacagtcatt ttttagacta tgggttcgag
    2251  gtcgtagccg aggcaccgaa atacatcact gaacaagttg agttttgtca
    2301  gatgcaacca gttttcgacg ggacgcaata tattatggtc cggaatcctg
    2351  cagtcagcat gagtaaagat agtcactcca tcacaccgtt ctacaccccc
    2401  aacaccatga agaaatggat ccgggctgta ggcgagtgtg gactttctct
    2451  caccgggggc atacccatta aacagtcata ttacaaatgc ttcatcagaa
    2501  acggcgctga caaggggaag atacacacta gtagagaatt cgcgagcgga
    2551  tttcaagcac tctcaaaact ctcgacgcgg aaggaaagag acatcagtac
    2601  ccaatcgagg tattccttct accttgcgtt cgggtacact ccggacgagc
    2651  aggtggctat ggaaaattac ttcgacaagc tggtgatcga tcccaacttc
    2701  tccgactcgg gatctccggc aagagcttcc gaatgtctac tcctccaact
    2751  aatccccaaa cagccgacga cacactcgca caagcgccca aacaagatcg
    2801  ccaagcaacc cgcgccgcaa gactcaacgt gggagccggt atcgctcgca
    2851  gaagtgcaga cgctgctgcc actcgggacg acaccgcatc tgcaagcttc
    2901  gtgatcatcg cggagagggt ggacgtcact aacaacttca acttcggata
    2951  aacctggcta ccggcacttg ccactgccca gacaatccct ttgtctggcc
    3001  attggttacg gttgtcctca tccttttaat catcatagtt gctagtgtca
    3051  ccagcacagg gcctgtcata attccgccct cacacaacac cacctatcac
    3101  cacgaaaagt accagaacat agaggtacag aaatgaatgg aggcaatacc
    3151  tctaaccgaa ggggacgtgg caaggcatta caaagacgga ctaataagcc
    3201  tcctagaagt aggtccatcg agcgtgctcg cccattggcc tatggccaag
    3251  ctgtgggccc gtcacccccc cggacagtgg cttatcgacg aggccggcag
    3301  gtcaataccc agccggaaat catacttcgc atcactgcca agacgaccga
    3351  taactacacg actgtgccca tcatacctgc gctcttgttc gaccccagca
    3401  cacaacctgg atatggggga cgagctcagt atatggccgg tttatctcag
    3451  ctccactctc aacatgagtg gaggcggttg cagttcacct ggatacccag
    3501  ctgtgccacg gttacaccgg gaaatgtggt tctaaagttc ttcccgaact
    3551  acaggacccc tcttcccaca gtgctcgagg atcttatgga cacctcgtcc
    3601  ttgaccttca gcccatatga gaagcacacc ttttcggtgg ctggacgcat
    3651  tagtggccta aaatacaaca tcggggccac tgcgtttctt gcactatccg
    3701  atgaagacaa aggcgactat agcatcggaa ggctcgtcat cggaacgacg
    3751  agtcaagtgt cggcggtctc cctaggtatc atacaaatgg tacccgacgt
    3801  ggaattctca ggaccggtca ccactcccgt ggcaccgaca cccgccgcta
    3851  ctgcggctgc gccagcctaa cctcctaggc tatacgaggt tagagtcgac
    3901  ctgttaaaca gactcacctc gggcacgcgc tgaaagtgcc cgttggaagg
    3951  attgcgatgg gccagtattc ctactgtacc agagaacgtg tcatcagggg
    4001  atgaccatgt ccaccttgcc gggtgccctc ggacctatgt ccgtgacatg
    4051  gcgtgacgct agtaatggtg ctatggaaga aacacctaac cctccaagca
    4101  aaaccccaca ggaaactgtg ggggggcggc tatggaggga ttcgccaatc
    4151  tcatctgaga agattggggt acctccatga gaggacccac ccccgccc