Sequence of DPV Maize chlorotic mottle virus

Maize chlorotic mottle virus isolate Nebraska, complete genome.

ACC No: EU358605

Dated: 2008-04-22 | Length: 4436 | CRC: -1821371072

                
ID   EU358605; SV 1; linear; genomic RNA; STD; VRL; 4436 BP.
XX
AC   EU358605;
XX
DT   22-APR-2008 (Rel. 95, Created)
DT   22-APR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Maize chlorotic mottle virus isolate Nebraska, complete genome.
XX
KW   .
XX
OS   Maize chlorotic mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Machlomovirus.
XX
RN   [1]
RP   1-4436
RX   PUBMED; 18365127.
RA   Stenger D.C., French R.;
RT   "Complete nucleotide sequence of a maize chlorotic mottle virus isolate
RT   from Nebraska";
RL   Arch. Virol. 153(5):995-997(2008).
XX
RN   [2]
RP   1-4436
RA   Stenger D.C., French R.;
RT   ;
RL   Submitted (19-DEC-2007) to the EMBL/GenBank/DDBJ databases.
RL   CDPGRU, USDA-ARS, 9611 S. Riverbend Ave., Parlier, CA 93648, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4436
FT                   /organism="Maize chlorotic mottle virus"
FT                   /isolate="Nebraska"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /virion
FT                   /db_xref="taxon:12138"
FT   gene            118. .987
FT                   /gene="P32"
FT   CDS             118. .987
FT                   /codon_start=1
FT                   /gene="P32"
FT                   /product="P32"
FT                   /note="hypothetical protein"
FT                   /protein_id="ACA57839.1"
FT                   /translation="MPSPCTYGDPTFNSRILEAVVADVLGGTEDDGGPSLEEWFDAQTL
FT                   SDYTNCATDPPMATVHTRENDIKSWTELSENFPDLVRYPESLVETLLDTEHECGHFYDA
FT                   PDSFQISVTAMFTDRCKCQSCDPNFQARSLSRALLGPLPESGDDAEWMEQAYTPDAELF
FT                   VNEPTDDPIPTTDCKRPIQPTWSVDVHSKQVDSDWGLSDSTNVTVCSASSSLLPAGRGG
FT                   IYFMCPRPEGIERVCLQVGAKIRSGAPNSGTITNLPGGTGYGTEWSDDGYETQWSDGPY
FT                   SIPSGLSD"
FT   gene            137. .3034
FT                   /gene="P111"
FT   CDS             137. .3034
FT                   /codon_start=1
FT                   /transl_except=(pos:1451. .1453,aa:OTHER)
FT                   /gene="P111"
FT                   /product="P111"
FT                   /note="RNA dependent RNA polymerase; read through product
FT                   of amber stop codon"
FT                   /protein_id="ACA57840.1"
FT                   /translation="MATLPSIHAFWKLWWPTFSEERKMTVVQALRNGLTRKLFQITQIA
FT                   QQILRWPPYIRERMTSSLGQSLVKTFQTLLGIRKALSRLCLTRNMNVDIFTMLLIPFKF
FT                   LSQLCSQIVASANHVIQTFRHGLSRGLCLARCRNPETMRSGWSKHTLQMQNCSSTSPLM
FT                   TPFQPQIVRDLSNPHGLWMSTRNKLTRTGGSAIQQTSRYVRLAVRFSLLAAGAYISCVL
FT                   ARKALKEYVYRWELKSDQELPTREQSQISQVEQAMEQNGAMMVMKLNGPTAPILSLQDC
FT                   LTKHVLVPEIVDEEGTVTQKEQSTFLIREFGPAVRNLVTLAKLEFGGIPKKTTANELTV
FT                   WRFLVRKCEHANMNPTDSRTAISMALPYVFMPCRTDVGRASIPLRDESIEICRQYRAQF
FT                   VEETPLRRVFNNPLSGKAWRNWVRHLGGLDDPALFQELKXGCLEEWLGVQSRRTRARHP
FT                   KLRSHFKDTRHKTRRVFRIAGLGNLYEFGVHNNSAVNLERGLMERVFYVKDDKGELVSC
FT                   PEPISGIFWKNLKGFRNSIVHHVGHRHPVSRETFLAYYTGPKRTMYEKAVNSLYEMPVS
FT                   YDDAKLKTFVKAEKINLTKKADPVPRVIQPRAPRYNVELGRYLRPVEHPIYHAIDKIWG
FT                   GPTIMKGYSVEQIGRHIENAFRSFTDPVAIGFDASRFDQHVSVEALRWEHSVYSRIYGY
FT                   PELLTQLLRWQIHNRGTAYASDGAFNYQVDGKRMSGDMNTSLGNCILATAITHDFVTKL
FT                   GIPARLINNGDDNVLICPAVEVGRVRQELYRHWLNYGFEVISEEPVYILEQVEFCQMRP
FT                   VFDGTQYTMMRDPRTTMSKDAYAVTPFNTPTAARRWMRAVGECGLSLTGGLPVKQEYYT
FT                   ALVKHGLDPKNIKQGKDFDSGLYYLSKLSNRKWQEVQESARYSFWLAFGYTPDEQRALE
FT                   EYFKSWTPTFEWSTTGILAEIPECLLLKYNPLPPT"
FT   gene            137. .1453
FT                   /gene="P50"
FT   CDS             137. .1453
FT                   /codon_start=1
FT                   /gene="P50"
FT                   /product="P50"
FT                   /protein_id="ACA57841.1"
FT                   /translation="MATLPSIHAFWKLWWPTFSEERKMTVVQALRNGLTRKLFQITQIA
FT                   QQILRWPPYIRERMTSSLGQSLVKTFQTLLGIRKALSRLCLTRNMNVDIFTMLLIPFKF
FT                   LSQLCSQIVASANHVIQTFRHGLSRGLCLARCRNPETMRSGWSKHTLQMQNCSSTSPLM
FT                   TPFQPQIVRDLSNPHGLWMSTRNKLTRTGGSAIQQTSRYVRLAVRFSLLAAGAYISCVL
FT                   ARKALKEYVYRWELKSDQELPTREQSQISQVEQAMEQNGAMMVMKLNGPTAPILSLQDC
FT                   LTKHVLVPEIVDEEGTVTQKEQSTFLIREFGPAVRNLVTLAKLEFGGIPKKTTANELTV
FT                   WRFLVRKCEHANMNPTDSRTAISMALPYVFMPCRTDVGRASIPLRDESIEICRQYRAQF
FT                   VEETPLRRVFNNPLSGKAWRNWVRHLGGLDDPALFQELK"
FT   gene            2995. .3834
FT                   /gene="P31"
FT   CDS             2995. .3834
FT                   /codon_start=1
FT                   /transl_except=(pos:3199. .3201,aa:OTHER)
FT                   /gene="P31"
FT                   /product="P31"
FT                   /note="read through of ocher stop codon"
FT                   /protein_id="ACA57842.1"
FT                   /translation="MSSSQIQSPPTDVARRQQTGTAVRSEDNHRNQLENIAVGKLTKSE
FT                   GAPAQQNVIIAKEVVINNHFNFNXAGVCVCRFVLASVVKEFNLGDFDLLDSVHLDEDTG
FT                   HRCRLSRAIGVLDRSDTKIPKDRHTQWQQVAGLPEVESSADVAWKQNPELFEPTRLSLD
FT                   PTRSETVPPLREQPAPCPKFCLQCQQQLLTRFSRFQCVQGLTSRLERRPDTLGRPNGWQ
FT                   HNHRCGIQLCSTLCVSLGRHSQQTPLADTFPWHSSPITCYQYPLGWRMLPGSCPQLQ"
FT   gene            2995. .3201
FT                   /gene="P7"
FT   CDS             2995. .3201
FT                   /codon_start=1
FT                   /gene="P7"
FT                   /product="P7"
FT                   /protein_id="ACA57843.1"
FT                   /translation="MSSSQIQSPPTDVARRQQTGTAVRSEDNHRNQLENIAVGKLTKSE
FT                   GAPAQQNVIIAKEVVINNHFNFN"
FT   gene            3384. .4094
FT                   /gene="CP"
FT   CDS             3384. .4094
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /note="structural protein of virion"
FT                   /protein_id="ACA57844.1"
FT                   /translation="MAASSRSTRGRKQRGRSVEAKSRAIRANPPVPRPNPQRNRPPPAG
FT                   TTCSMSEILLAVSATTADQILEIPVCAGIDFPAGTSPRYIGAAKWLAAQSQMWNTIVFN
FT                   SVRITWETFTADTTSGYISMAFLSDYMLSIPTGVEDVARIVPSATIALKNRGPSIVMPQ
FT                   NRTVFRCIQAGQFAALGSAADKQMYSPGRFIVAIPKASATQAVGQIKISYSVSYRGAAI
FT                   LQPALVPGPGLANH"
XX
SQ   Sequence 4436 BP; 1198 A; 1114 C; 1110 G; 1014 T; 0 other;

eu358605 Length: 4436  22-APR-2008  Type: N  Check: 6680  ..

       1  aggtaatctg cggcaacaga ccccaacgcg ttagacacga ccttacagtt
      51  gactcacgtc ttgcatcctg tgagagctct aacgtgggaa tttgcccctg
     101  actggcaatc aggtttcatg ccctctccct gcacttatgg cgaccctacc
     151  ttcaattcac gcattttgga agctgtggtg gccgacgttc tcggaggaac
     201  ggaagatgac ggtggtccaa gccttgagga atggtttgac gcgcaaactc
     251  tttcagatta cacaaattgc gcaacagatc ctccgatggc caccgtacat
     301  acgcgagaga atgacatcaa gtcttggaca gagcttagtg aaaactttcc
     351  agaccttgtt aggtatccgg aaagccttgt cgagactctg cttgacacgg
     401  aacatgaatg tggacatttt tacgatgctc ctgattcctt tcaaatttct
     451  gtcacagcta tgttcacaga tcgttgcaag tgccaatcat gtgatccaaa
     501  ctttcaggca cggtctctct cgcgggctct gcttggcccg ttgccggaat
     551  ccggagacga tgcggagtgg atggagcaag catacactcc agatgcagaa
     601  ttgttcgtca acgagcccac tgatgacccc attccaacca cagattgtaa
     651  gagacctatc caacccacat ggtctgtgga tgtccactcg aaacaagttg
     701  actcggactg ggggctcagc gattcaacaa acgtcacggt atgttcggct
     751  agcagttcgc ttctccctgc tggccgcggg ggcatatatt tcatgtgtcc
     801  tcgcccggaa ggcattgaaa gagtatgtct acaggtggga gctaaaatcc
     851  gatcaggagc tcccaactcg ggaacaatca caaatctccc aggtggaaca
     901  ggctatggaa cagaatggag cgatgatggt tatgaaactc aatggtccga
     951  cggcccctat tctatccctt caggactgtc tgactaaaca cgttctggtt
    1001  ccagagattg tggacgaaga aggcacagta acacaaaaag aacagtccac
    1051  ttttctcatc cgtgagtttg gtcctgccgt cagaaaccta gtgaccctcg
    1101  caaagctaga attcggcgga attccaaaga aaaccacagc caatgaactt
    1151  acggtttggc ggttcttggt acggaagtgt gaacatgcaa atatgaaccc
    1201  aactgactcc cgtactgcca tttcaatggc cctgccatac gtgtttatgc
    1251  cgtgtcgcac tgatgttgga agagcttcaa ttccactgcg tgatgaatcc
    1301  attgaaatct gtcgccaata tcgcgcacaa tttgtggagg agacacccct
    1351  acggcgagta ttcaacaacc cattgagcgg aaaagcatgg cgtaactggg
    1401  ttaggcacct gggtgggctg gatgatccag ccctattcca ggagttgaaa
    1451  taggggtgtc ttgaagagtg gcttggggtg cagtctcggc gcacacgtgc
    1501  gcggcacccc aaactccgta gccactttaa agacacgaga cacaaaaccc
    1551  gcagagtgtt ccggattgca ggtttgggca acctgtatga atttggagtc
    1601  cacaacaact ctgcggtaaa cctggaacgt ggactaatgg agcgagtatt
    1651  ttatgtgaaa gatgataagg gggaactcgt ttcatgccct gagcctatta
    1701  gtgggatatt ttggaaaaac ttgaagggat tcagaaatag cattgttcac
    1751  catgtgggac acagacatcc agtgtcacga gagacgtttc tcgcttacta
    1801  tacagggcca aagcgcacca tgtatgagaa agcggtgaat tccctctacg
    1851  aaatgcctgt ctcatacgac gatgctaaac tgaaaacatt tgtaaaagca
    1901  gaaaagatca atctcactaa gaaagctgat cctgtaccac gtgtgatcca
    1951  gccccgtgct ccccggtata atgtggaact gggtaggtat ctgagaccgg
    2001  ttgagcaccc aatctaccat gctatagaca agatttgggg tggtccgact
    2051  attatgaaag gttactcggt tgaacagatt ggaagacata ttgagaacgc
    2101  gttccgatcg ttcaccgatc cagtggccat tggatttgat gcaagtcggt
    2151  ttgatcaaca cgtgagtgtt gaagctctac gctgggaaca tagcgtatac
    2201  tcacggattt atggctatcc agagcttctc acacaattgc tgcggtggca
    2251  gattcataat cgcggaacag catacgcctc agacggcgcg ttcaactacc
    2301  aggtggatgg taaacgcatg agtggggaca tgaacacatc attgggcaat
    2351  tgcatcctgg ccacagcaat cacacatgac ttcgtgacca agctgggaat
    2401  tccagccaga ttaatcaaca atggagatga caacgtcctg atctgtccgg
    2451  cagtggaggt aggcagagtc agacaggaac tgtacagaca ttggttgaac
    2501  tacggatttg aagtcatatc agaagaacct gtgtacatcc ttgaacaggt
    2551  tgaattttgc cagatgcgac cagtcttcga cggtacacaa tacaccatga
    2601  tgagagaccc ccgcaccacc atgtccaaag atgcctatgc tgtaacccct
    2651  tttaacacac caaccgcagc aaggaggtgg atgagagcag ttggggaatg
    2701  cggactcagc cttacaggag gcctccccgt aaagcaggaa tactatactg
    2751  ctctcgtaaa acacggacta gatccgaaaa acatcaaaca gggaaaagac
    2801  tttgacagtg ggctatacta tcttagcaag ttatccaatc gcaaatggca
    2851  ggaggtccaa gagagcgctc gctactcatt ctggcttgct ttcgggtaca
    2901  caccagatga acaacgagcg ttagaggagt attttaaatc ttggactcct
    2951  acgtttgaat ggtccacaac gggtattttg gcagaaattc ccgaatgtct
    3001  tcttctcaaa tacaatcccc tcccaccgac gtagcccgca gacaacagac
    3051  cggtactgcc gtgcgatctg aagacaacca tcgcaatcag ttggaaaaca
    3101  ttgctgttgg aaaactcact aaatctgaag gagcacctgc ccaacagaac
    3151  gtgatcattg cgaaagaggt ggttatcaat aaccacttca atttcaactg
    3201  agctggagtg tgtgtgtgta gattcgtcct ggcctcagtg gttaaggaat
    3251  ttaatcttgg ggattttgat ctcctcgatt ctgttcatct tgacgaagac
    3301  acaggacacc gttgccgttt atcacgagcc atcggtgtac tcgatcgatc
    3351  agacacaaaa attccaaaag atcgacatac acaatggcag caagtagccg
    3401  gtctacccga ggtagaaagc agcgcggacg tagcgtggaa gcaaaatcca
    3451  gagctattcg agccaacccg cctgtccctc gacccaaccc gcagcgaaac
    3501  cgtccccccc ctgcgggaac aacctgctcc atgtccgaaa ttctgcttgc
    3551  agtgtcagca acaactgctg accagattct cgagattcca gtgtgtgcag
    3601  ggattgactt cccggctgga acgtcgcccc gatacattgg ggcggccaaa
    3651  tggctggcag cacaatcaca gatgtggaat acaattgtgt tcaactctgt
    3701  gcgtatcact tgggagacat tcacagcaga caccactagc ggatacattt
    3751  ccatggcatt cctctccgat tacatgttat caatacccac tggggtggag
    3801  gatgttgcca ggatcgtgcc ctcagctaca atagctctga agaacagagg
    3851  gccatccatt gtcatgccac agaaccgcac tgtgttcagg tgtatacagg
    3901  ctggtcagtt tgctgcattg ggcagcgctg ctgacaagca aatgtattcc
    3951  ccaggacgat tcattgtggc tatccctaaa gctagtgcaa cacaagcggt
    4001  aggccaaatc aaaatctcgt actccgtgtc ctaccgtgga gcagcgatcc
    4051  tacaacccgc cctggttcca ggcccagggc tggcaaatca ttgaacacaa
    4101  ggtgagccgg catgaggttg caagaccgga ataaccagtc cttctggcag
    4151  agtcctgcca atccaaagtg tttgggagcc taaatcgtat actagtagtt
    4201  tgcgtgatga ccatgactgg agagtgggcg gcggctgcca accgcagact
    4251  gggcgtatat agtaagcctt gacccaccca tggacaacac gtacttacga
    4301  acggtgcgac atggtaactg gatacactta accctggggc aagtagatgc
    4351  taggaaacta gcatcgggcc gcccacgagg gtttctgaac tcaacggagt
    4401  agaacggggg ggggtaatgc ccctctcttc cggccc