Sequence of DPV Carrot mottle mimic virus

Carrot mottle mimic virus isolate California RNA-dependent RNA polymerase, long-distance movement protein, and cell-to-cell movement protein genes, complete cds.

ACC No: FJ188471

Dated: 2008-11-03 | Length: 3655 | CRC: -107448865

                
ID   FJ188471; SV 1; linear; genomic RNA; STD; VRL; 3655 BP.
XX
AC   FJ188471;
XX
DT   03-NOV-2008 (Rel. 97, Created)
DT   03-NOV-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Carrot mottle mimic virus isolate California RNA-dependent RNA polymerase,
DE   long-distance movement protein, and cell-to-cell movement protein genes,
DE   complete cds.
XX
KW   .
XX
OS   Carrot mottle mimic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Umbravirus.
XX
RN   [1]
RP   1-3655
RA   Menzel W., Maiss E., Vetten H.J.;
RT   "Complete nucleotide sequence of a carrot isolate of Carrot mottle virus
RT   from Germany";
RL   Unpublished.
XX
RN   [2]
RP   1-3655
RA   Menzel W., Maiss E., Vetten H.J.;
RT   ;
RL   Submitted (05-SEP-2008) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Pflanzenkrankheiten und Pflanzenschutz, Leibniz Universitaet
RL   Hannover, Herrenhaeuser Strasse 2, Hannover 30419, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3655
FT                   /organism="Carrot mottle mimic virus"
FT                   /host="Daucus carota"
FT                   /isolate="California"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collected_by="B.W. Falk"
FT                   /db_xref="taxon:47736"
FT   CDS             join(1. .939,939. .2648)
FT                   /codon_start=1
FT                   /ribosomal_slippage
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="RdRp"
FT                   /protein_id="ACJ03572.1"
FT                   /translation="MDHITKFLRMDFSPKDGVLTRRQCAERFDDTWGLLVTQARMTTAH
FT                   TADMCAWYEGSRETNQYLPLEQFVDSRDASKEAEDKVDKVSSPLTRSCGGTMVNADGGL
FT                   VDNPLPTDRDEMPAASMQMNAPSGGVAVASVNSEVARWVFALPRELDDPVMETPVNPSA
FT                   PTEADRELTRVLNNTVAVGDIASALSTIQEEPQHEAIAVPGTAVGVVHQEDPAPVEGSP
FT                   STRDAALEGDAGHSAHAGDDTDASAEMPTTVEAAGPLMEEGPSMAHLTSYTVAMELRSR
FT                   FGLRPASPANIELGARVAREILKTAGARRQDNLLSSPAGSQVFPDADTPGCGVQHTHPG
FT                   FLLGDVIARDGVCTKTVPIILSPSLHIRPSARPRPVKRVSYQIDAVRPSADFGVHNNSL
FT                   VNLVRGINERVFYTDNRGSLPVRPTPGSFDRLTVDIKHFKINAWSMEDVVNSYTGRQRA
FT                   RYEQAMLSIMERPLERRDARVSTFIKAEKINFSAKPDPAPRVIQPRDPRFNVVFAKYIK
FT                   PLEPMLYKALGRLYKQPCVAKGFNAFQTGEIIRKKWDSFRNPVCVGLDASRFDQHVSVE
FT                   ALKFTHSVYKRFNSSKEFVDLLNQMYVNRGLGTCKDGLVKYKVKGCRMSGDMDTALGNC
FT                   VLMVLMTRNLCLDLSIPHELMDNGDDCIVIFEKEHLQRFNAAVKPYFAALGFTMKVEAP
FT                   VYQFEKVEFCQTQPVFDGTQWRMVRQIPSIAKDLCSVIDWEQLESWWHAIGNCGQSLAG
FT                   GLPVFGSFYRWLCRIGKDNTKVTEHPLYKCGMVNLSRGMDARDKPITTEGRLSFSLAFG
FT                   LSIPMQIALEGIYDNLKKPGKVVPGACERRGFNDWFIPDAQCLNPSRSAVHTDEVEVEV
FT                   DFLYPPPVSAC"
FT   CDS             2770. .3567
FT                   /codon_start=1
FT                   /product="long-distance movement protein"
FT                   /protein_id="ACJ03573.1"
FT                   /translation="MGIVMNLQIQPIGDGNNSSRNSRRPNQPSPRRRDSRQASGSWLWC
FT                   PNTSPRQQYPYMYATIPPRAPTNGPGFLHPEMAHEAQWGPPVYREASGGFPATRARRNR
FT                   GRGSAVAPRYGPVGPGTGRPQSVTEPQRGTAAGRFLSELLYSFERFGRECPAMFLPSDP
FT                   ASRHPPEDWLQRLLPALNVEPSHRREGPTLPSNRAGVCAHSKALDKELVADTSTTAAVS
FT                   ERRADEPTRKEPEGQPITEAPSTGLCSKPHTRGEQCSDPTLHF"
FT   CDS             2810. .3598
FT                   /codon_start=1
FT                   /product="cell-to-cell movement protein"
FT                   /protein_id="ACJ03574.1"
FT                   /translation="MAIIQAGTREDLINLLHGAGIQDKLRDLGFGVLTPARGSNTLTCT
FT                   PLYPPEHQRTVRDFFTRKWRTKRSGGLLFIEKLVVAFLPHVPDGTAGEVVLWLHDTALS
FT                   DLEPVGRKVSLSLSGGPRLVAFYPNYSIPLSDSAESAPRCFSLVTQLQGIRLKTGSSAF
FT                   SLLSMWNPVIGEKAQHYQATEPECVPIVRHSIRSSLQTLALQRQYLNAALTNPLGRSQR
FT                   GSQSLRHPPLDYALSPTREASSVQIPPSTSSATKAHQYLE"
XX
SQ   Sequence 3655 BP; 913 A; 938 C; 980 G; 824 T; 0 other;

fj188471 Length: 3655  03-NOV-2008  Type: N  Check: 8113  ..

       1  atggatcaca taactaagtt cttgcgaatg gatttctcgc ccaaagatgg
      51  cgtcctaacc agacgccaat gtgctgaacg cttcgatgac acctggggac
     101  tcctagttac ccaggcgaga atgaccacag cgcacacagc ggatatgtgt
     151  gcatggtacg aggggtcccg ggagaccaac cagtaccttc ccctagagca
     201  gttcgtggac tccagggatg ccagcaagga agctgaagac aaggtggaca
     251  aagtgtcctc tcccctcacc cgaagctgtg gtggtaccat ggtaaatgct
     301  gatgggggcc ttgtggataa ccctctccca accgataggg atgagatgcc
     351  tgcagctagc atgcagatga acgccccatc gggtggcgtt gccgtggcct
     401  ctgttaatag tgaggtcgcg cgttgggtat ttgctctacc ccgtgaactg
     451  gatgaccctg ttatggagac tccagtaaac ccgtctgctc ctacagaggc
     501  agatcgagag ttgacgcggg tattgaataa taccgttgct gtcggggaca
     551  ttgcatcggc actgtccacc atccaggaag agccacaaca cgaggcaatt
     601  gctgtacctg ggacagccgt aggagtggtc caccaagagg acccagcccc
     651  agtagagggc tcccctagta caagggatgc cgccctggaa ggcgatgcgg
     701  gccactcagc ccatgccggt gatgataccg atgcctctgc ggagatgccc
     751  acgaccgtgg aagcagcagg gcccctaatg gaagaggggc catccatggc
     801  tcacttaacg agctacacag tagccatgga actcaggtct agattcggcc
     851  tgcgaccggc cagccccgct aatatagaat taggggcgcg agttgctagg
     901  gagatcttga agaccgctgg ggctagacgc caagataact attatctagc
     951  ccagcaggca gtcaagtttt tcctgacgcc gacactcctg gatgtggtgt
    1001  acagcacacc catccgggat ttttattagg ggacgtcatt gcgagggatg
    1051  gggtgtgtac taaaacagta cctatcatat tgagcccctc cttgcacatc
    1101  aggccgtccg cacgtccccg gcctgttaaa agggtatctt accagattga
    1151  cgcggtaagg ccctctgctg attttggagt tcacaacaac tccttggtga
    1201  atctcgtgag gggaataaat gagcgagtgt tctacactga taatcgtggc
    1251  tctcttcctg ttagacccac cccaggtagc tttgaccgtt tgaccgtcga
    1301  cattaagcac ttcaaaatta atgcttggtc catggaagac gttgtcaaca
    1351  gttataccgg gagacaaagg gcaaggtatg agcaagcgat gttatctatc
    1401  atggaacgac cgctagaacg gagggatgct agggtgtcta catttataaa
    1451  agcggagaag atcaactttt ctgccaagcc agacccagct ccccgagtca
    1501  tccaaccccg agatcccagg ttcaatgtgg tattcgcaaa atatattaaa
    1551  ccacttgagc caatgttgta caaagctctg ggcaggctgt ataaacaacc
    1601  gtgtgtcgcc aagggattta atgcctttca aactggtgag ataattagga
    1651  agaagtggga ttcattccga aatccagttt gtgtagggct agacgctagc
    1701  cgatttgacc agcatgtgtc agttgaagcc ttaaagttca cacattctgt
    1751  gtacaagcgg ttcaactcct ctaaggagtt tgtggacctg cttaaccaga
    1801  tgtacgttaa tcgtggactt ggcacttgca aagatggtct tgtcaagtat
    1851  aaggtgaagg gttgcagaat gagcggtgat atggataccg ccctgggcaa
    1901  ttgtgttctc atggtcttaa tgacacgcaa tttgtgttta gacctgtcca
    1951  tcccccatga gttgatggac aatggtgacg attgcatcgt catttttgag
    2001  aaggagcact tgcaaaggtt caatgcagct gttaagccat acttcgcagc
    2051  gttgggcttc accatgaaag tagaagcccc tgtttaccaa tttgagaaag
    2101  tcgaattttg ccaaacccag ccagtatttg atggcaccca atggagaatg
    2151  gttaggcaaa ttcctagtat cgctaaggac ctatgtagcg taatcgattg
    2201  ggaacagcta gaatcttggt ggcacgcgat aggaaactgc ggccagagct
    2251  tggcgggggg attgccagtg tttggcagtt tttaccgttg gttgtgtaga
    2301  atcgggaaag ataatactaa agtgaccgag catccactgt acaaatgcgg
    2351  catggtcaac ctttcccgtg gaatggatgc gcgagataag cccatcacaa
    2401  cagagggacg ccttagcttc agcctagcgt ttggattgtc cattccaatg
    2451  caaatagcat tggagggtat atatgacaat cttaagaaac caggcaaggt
    2501  agtcccgggg gcttgtgaaa ggcgaggatt taatgactgg tttataccag
    2551  atgctcagtg ccttaaccca tccagatctg cagtccacac cgacgaggtt
    2601  gaggtggagg ttgatttcct ctaccctcct cccgtttccg cctgttgagg
    2651  cagtcacgta gctagtacca ggttgcaata ctagagcgtt agtcctgggg
    2701  cgtccctttg gtggagggcc gtcaaaccta gataactcag tcacctaatc
    2751  ctccactagg ctctggagga tgggcatcgt catgaactta cagatacaac
    2801  caataggcga tggcaataat tcaagcagga actcgagaag acctaatcaa
    2851  ccttctccac ggcgcaggga ttcaagacaa gcttcgggat cttggctttg
    2901  gtgtcctaac accagcccga ggcagcaata cccttacatg tacgccacta
    2951  taccccccag agcaccaacg aacggtccgg gatttcttca cccggaaatg
    3001  gcgcacgaag cgcagtgggg gcctcctgtt tatagagaag ctagtggtgg
    3051  ctttcctgcc acacgtgccc gacggaaccg cgggcgaggt agtgctgtgg
    3101  ctccacgata cggccctgtc ggacctggaa ccggtaggcc gcaaagtgtc
    3151  actgagcctc agcgggggac cgcggctggt cgctttctat ccgaattact
    3201  ctattccttt gagcgattcg gcagagagtg ccccgcgatg tttctcccta
    3251  gtgacccagc ttcaaggcat ccgcctgaag actggctcca gcgccttctc
    3301  cctgctctca atgtggaacc cagtcatagg agagaaggcc caacactacc
    3351  aagcaacaga gccggagtgt gtgcccatag taaggcactc gataaggagc
    3401  tcgttgcaga cactagcact acagcggcag tatctgaacg ccgcgctgac
    3451  gaacccacta ggaaggagcc agaggggcag ccaatcactg aggcaccctc
    3501  cactggacta tgctctaagc cccacacgag aggcgagcag tgttcagatc
    3551  ccaccctcca cttctagtgc caccaaagcc caccaatacc ttgagtaagt
    3601  attggtgcgt atctgtactc acggcacccg ggttgtagat agtttccccc
    3651  gcgta