Sequence of DPV Soybean yellow mottle mosaic virus

Soybean yellow mottle mosaic virus from South Korea, complete genome.

ACC No: FJ457015

Dated: 2009-10-10 | Length: 4009 | CRC: 2080842355

                
ID   FJ457015; SV 1; linear; genomic RNA; STD; VRL; 4009 BP.
XX
AC   FJ457015;
XX
DT   16-DEC-2008 (Rel. 98, Created)
DT   10-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Soybean yellow mottle mosaic virus from South Korea, complete genome.
XX
KW   .
XX
OS   Soybean yellow mottle mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4009
RX   PUBMED; 19701603.
RA   Nam M., Kim S.M., Domier L.L., Koh S., Moon J.K., Choi H.S., Kim H.G.,
RA   Moon J.S., Lee S.H.;
RT   "Nucleotide sequence and genomic organization of a newly identified member
RT   of the genus Carmovirus, soybean yellow mottle mosaic virus, from soybean";
RL   Arch. Virol. 154(10):1679-1684(2009).
XX
RN   [2]
RP   1-4009
RA   Nam M., Kim S.M., Domier L.L., Kim Y.T., Moon J.K., Choi H.S., Kim H.G.,
RA   Koh S., Moon J.S., Lee S.H.;
RT   ;
RL   Submitted (12-NOV-2008) to the EMBL/GenBank/DDBJ databases.
RL   Agricultural Microbiology Division, National Academy of Agricultural
RL   Science, RDA, Suinro, 150th, Suwon, Gyeonggi-do 441-707, Korea
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4009
FT                   /organism="Soybean yellow mottle mosaic virus"
FT                   /host="Glycine max (soybean)"
FT                   /mol_type="genomic RNA"
FT                   /country="South Korea"
FT                   /collection_date="Jul-2008"
FT                   /db_xref="taxon:578361"
FT   CDS             40. .2280
FT                   /codon_start=1
FT                   /transl_except=(pos:721. .723,aa:OTHER)
FT                   /product="P84 protein"
FT                   /note="replicase protein; ORF1 and ORF2"
FT                   /db_xref="GOA:B7U995"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:B7U995"
FT                   /protein_id="ACJ68411.1"
FT                   /translation="MMIQFGTMPPVRIDGPPRAFSMGMALRAVGKFLVNCCSAFGDNWA
FT                   DSITRNRTQHVCALQYFGDLPIECIVKSTGDFAREPANVTREVGNEKRVVNRHAKGYFL
FT                   SEMVASCRLHFNGIPRSTEANLLGVRRYLATYCQEHRLTNQQTLKLVDVATPLVMTANH
FT                   QDVVSMKLMNDPLLNLYRTLHLEAQVVHTPLRQLVARPFSGTAWSQWIDSVRGYRDPRG
FT                   FRLAQXGCLRRVPGFNTKISRGDHPDMLITPRNGCHKVRYMGQVLGMSNGKHFGVHNSS
FT                   LTNLRRGLIERVFYVEGPKGLQPPPKPEPGIFQESLHGFKRKLMHVVGTHSRIGHDEFV
FT                   SLYHGRRRTIYQQAVDSLSVRSVERKDAYLSTFIKAEKIPLWKKPDPAPRVIQPRNPRY
FT                   NVEVGCYLRKFEHHLYRGINSIMGGPTVIKGYDVDQIGNIMEEAWNKFSDPVAIGFDMS
FT                   RFDQHVSEDALRFEHSVYLQHFNQDPNLAKLLSWQIDNKGYANLAEGKVRYKRRGCRMS
FT                   GDMNTALGNCLLACAITWKLMSGLKFRLLNNGDDCVVITDKSNERAVCERLKHFTRYGF
FT                   TCIAEKPVYELEHLEFCNLQPLNLGSHYTAVRKPTVSLSKDTFCVSGWNNDIDAANWLN
FT                   AIGQCGLALSAGVPVLQSYYSALIRNFPNGKWLSKNCGKLDSGFYRLALHTMGRKPVQV
FT                   SEVARFSFYVMTGVTPDAQVAVEKLYDNLIINRSFEPEGNAKPELDNLSSLI"
FT   CDS             2280. .2486
FT                   /codon_start=1
FT                   /product="P7 protein"
FT                   /note="ORF3"
FT                   /db_xref="GOA:B7U996"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:B7U996"
FT                   /protein_id="ACJ68413.1"
FT                   /translation="MDKSPQRGRSRSRSRQTQGPKGPKPENKQIQVAHHAVDKARGKPP
FT                   GGDHGGDFVIVAHTVTVNINFNI"
FT   CDS             2383. .2667
FT                   /codon_start=1
FT                   /product="P10 protein"
FT                   /note="ORF4"
FT                   /db_xref="UniProtKB/TrEMBL:B7U997"
FT                   /protein_id="ACJ68415.1"
FT                   /translation="MPSTRHEVNHLAVITGVILLLWHIRSQSILILIFDAIAPRVTNIT
FT                   SAILLAIFYCYSNSTASIPYISQPVTHSSTSKIVYIAVGTNPVAVSKHE"
FT   CDS             2664. .3728
FT                   /codon_start=1
FT                   /product="P38 protein"
FT                   /note="ORF5; coat protein"
FT                   /db_xref="GOA:B7U998"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:B7U998"
FT                   /protein_id="ACJ68412.1"
FT                   /translation="MNGKMLTIAQLAKKEKTEGRRALSKNQRKRLDSADTRPLKEVSST
FT                   ARVSTRRVPAAISSNVSNGVPNYAVRQNKPVIQHTELWGTLMSNSTESPAYIARTLNPS
FT                   DPATFNWVQPLSTGYDMYRLINCEIIYTPRCATTTTGSIVLAHDPDASDANPDNVTDLL
FT                   NMAGAVSGSVFSPLRIKPNIKQLDRYVRDNSTSDPKLVDAGKILVAAYGQQASTTPFAL
FT                   GEVRFSYTLQLLNPQPHSTMVQRLGAAPPPGVGPTYATLRTVNGATTSSNVLTFSTAGA
FT                   YLITAVDATAGLGTPVTTDFGRFRVQGTSAADSPLLMFGTALKSGATITFNGPVSNVLD
FT                   VYVVRDSGVSDNSS"
FT   CDS             2668. .3339
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /note="ORF6"
FT                   /db_xref="UniProtKB/TrEMBL:B7U999"
FT                   /protein_id="ACJ68414.1"
FT                   /translation="MEKCSPLPNSPRRRKQRDEELSPRTSESDSTPLTLDPSRKSAAPL
FT                   ECQHEESPLPSRPMCPMEYRTTLFDKTNRSFSILSYGELLCLIALSPLLISLGHSTQVI
FT                   LQHSIGCNRSPQGMICTDSLIVRSSTLPGVRLPLRDRLSWRMIQTLVMLTLIMSLTCLT
FT                   WLALSLARSSLPSGSSQTLNSSTVMFVTILLATPSWLMLARYWLQHMDSKLQQPPSPSA
FT                   K"
XX
SQ   Sequence 4009 BP; 1045 A; 1005 C; 1006 G; 953 T; 0 other;

fj457015 Length: 4009  10-OCT-2009  Type: N  Check: 9367  ..

       1  gggtaaccca gccagttatc caccatttaa tctttcagga tgatgatcca
      51  attcggaaca atgccacctg tcagaattga tggacctcca cgagcttttt
     101  cgatggggat ggctctcaga gcggttggga aattcttagt caactgttgc
     151  tctgctttcg gcgataactg ggccgacagt atcaccagga accggactca
     201  acacgtctgc gcactccaat attttgggga cctccccatt gagtgcatag
     251  tgaagagcac cggggacttt gcaagggaac cagccaatgt caccagggaa
     301  gtcgggaatg agaagcgtgt tgtcaatagg cacgccaaag ggtacttcct
     351  aagtgagatg gtggcgagtt gccggttaca cttcaacggc attcctcgct
     401  ccactgaggc caacctccta ggagttaggc gctacctggc aacatattgc
     451  caggagcata ggttgaccaa ccagcagaca ttgaagttgg tcgatgttgc
     501  cacccccctt gtaatgactg ccaatcatca ggatgtggtt tccatgaagt
     551  tgatgaatga cccgttactt aacttgtatc ggacactaca tttggaagcc
     601  caggtggtgc acaccccatt acggcaactc gtcgcccgtc ccttctctgg
     651  gaccgcttgg agccagtgga tcgactccgt taggggttat agggacccga
     701  gagggttccg gctcgctcaa taggggtgcc taaggcgtgt gccagggttt
     751  aatactaaaa taagtcgtgg cgaccaccct gacatgctaa tcacgcctag
     801  gaacggatgc cacaaggtaa ggtacatggg tcaggttttg gggatgtcca
     851  acgggaagca ctttggagta cacaactcca gtctaaccaa tcttcggaga
     901  ggtttgatcg agagggtgtt ctacgttgaa ggacccaaag ggctacagcc
     951  cccacccaaa ccagaacccg gtatcttcca agagtcttta cacggtttca
    1001  aacgcaagtt gatgcatgtg gttggtactc attccaggat cggacatgac
    1051  gaatttgtgt ccttgtatca tggcaggagg aggaccatat accaacaggc
    1101  ggttgattcc ctttctgtga gatctgtaga gaggaaggat gcttatttga
    1151  gtactttcat caaagcagag aagatcccgc tttggaagaa gccagaccca
    1201  gctccccgag taatccagcc gcgaaatcca agatacaacg tggaagtggg
    1251  gtgctatttg agaaagtttg aacaccactt gtacagaggg ataaactcaa
    1301  tcatgggtgg acccactgta atcaagggct atgatgtgga tcagatcggt
    1351  aacataatgg aagaagcgtg gaacaaattc tcagacccgg ttgcaatcgg
    1401  gtttgacatg agtcggtttg accagcatgt ttccgaggat gctttgcggt
    1451  ttgaacatag tgtgtatttg cagcatttca accaagaccc taatttagca
    1501  aagctgctgt catggcagat tgataacaaa ggatacgcca atctggctga
    1551  agggaaagtg aggtacaaac gaagaggatg cagaatgagt ggtgacatga
    1601  acaccgcctt gggcaattgt ctattggcat gtgccatcac gtggaaactc
    1651  atgtctgggc tgaagttccg gttattaaac aacggtgacg attgtgttgt
    1701  tataacagat aaatcgaatg agagagccgt ttgtgagaga ctgaagcact
    1751  tcacccgata tggattcacg tgcatcgccg aaaagcctgt atacgaacta
    1801  gagcatctcg agttctgcaa cctccaacct ttaaaccttg ggagtcacta
    1851  cacagcagtg cgtaagccta cagtcagtct atcaaaggac accttctgcg
    1901  tgtcaggatg gaataacgac attgatgcag caaactggtt gaatgctatt
    1951  ggacagtgtg ggctcgcatt gtcagctggg gtgccagtgt tacagagcta
    2001  ctattccgca ttgatccgga acttcccaaa tggtaaatgg ctttctaaga
    2051  actgtgggaa attggatagt gggttttacc gcctagcgtt acatacgatg
    2101  ggccggaagc cggttcaggt tagtgaggtt gctaggttct ccttctatgt
    2151  gatgactggg gtcacccctg acgcccaagt ggctgtggag aaactgtatg
    2201  acaacctgat tataaatcgt tcattcgaac cggagggaaa cgccaagccc
    2251  gaacttgaca atttatcttc tctcatataa tggacaaatc tccccaaagg
    2301  ggacgtagta gaagcaggag ccggcaaaca caagggccaa agggacctaa
    2351  gccagagaac aagcagattc aagttgccca ccatgccgtc gacaaggcac
    2401  gaggtaaacc acctggcggt gatcacgggg gtgattttgt tattgtggca
    2451  catacggtca cagtcaatat taattttaat atttgacgca atcgccccta
    2501  gggtaacaaa cataacatct gccattcttc tagccatttt ctattgctat
    2551  tccaactcta ctgcaagcat tccttacatt tctcagccag taacacactc
    2601  tagtacgtct aagatagttt atatagccgt tgggacaaat cctgtcgcag
    2651  tcagtaagca cgaatgaatg gaaaaatgct caccattgcc caactcgcca
    2701  agaaggagaa aacagaggga cgaagagctc tctccaagaa ccagcgaaag
    2751  cgactcgact ccgctgacac tcgacccctc aaggaagtca gcagcaccgc
    2801  tagagtgtca acacgaagag tccccgctgc catctcgtcc aatgtgtcca
    2851  atggagtacc gaactacgct gttcgacaaa acaaaccggt cattcagcat
    2901  actgagctat ggggaactct tatgtctaat agcactgagt cccctgctta
    2951  tatcgctcgg acactcaacc caagtgatcc tgcaacattc aattgggtgc
    3001  aaccgctctc cacagggtat gatatgtaca gactcattaa ttgtgagatc
    3051  atctacactc ccaggtgtgc gactaccact acgggatcga ttgtcttggc
    3101  gcatgatcca gacgctagtg atgctaaccc tgataatgtc actgacctgc
    3151  ttaacatggc tggcgctgtc tctggctcgg tcttctctcc cctcaggatc
    3201  aagccaaaca ttaaacagct cgaccgttat gttcgtgaca attctactag
    3251  cgaccccaag ctggttgatg ctggcaagat attggttgca gcatatggac
    3301  agcaagcttc aacaaccccc ttcgccctcg gcgaagtgag gttttcatac
    3351  acgctccagc tgctcaaccc tcagccacat tcaactatgg tgcaacgact
    3401  cggggctgcc ccaccccctg gggtgggccc cacttacgca accttgcgta
    3451  cagttaatgg tgccaccaca tccagcaatg ttctcacatt ttcgactgct
    3501  ggcgcctacc tcatcactgc cgttgacgca acagctgggc tcggaacccc
    3551  ggtcaccact gattttggcc ggttccgcgt acagggcact agtgctgcgg
    3601  actccccact actgatgttt ggaacagccc tcaagagtgg ggctaccatt
    3651  accttcaatg ggcctgtctc caacgttttg gatgtttatg ttgtgcgcga
    3701  tagcggagtt agcgacaact ctagctagag cttgtaaatt tacatctcat
    3751  tgaaaacccc tcacacaatc cctctacctc gatggggcca gcgtctgtca
    3801  ctgggcagca tggcgaaccg acgttctagg gtaaggttgg cacctgtgtg
    3851  tttgggaccc aaaaatagag tgaaattagt gtgtgtctcc cacattcgtg
    3901  ggcggttgca agagccgacg taacgtatct agccagaaat ccttcgggtg
    3951  gggtggttag aaacagcaaa tcttgacctg ataggccccg ggcatgcggg
    4001  gcccccccc