Sequence of DPV Soybean yellow mottle mosaic virus

Soybean yellow mottle mosaic virus strain Goesan coat protein (CP) gene, complete cds.

ACC No: FJ494835

Dated: 2008-12-24 | Length: 1065 | CRC: 514753435

                
ID   FJ494835; SV 1; linear; genomic RNA; STD; VRL; 1065 BP.
XX
AC   FJ494835;
XX
DT   24-DEC-2008 (Rel. 98, Created)
DT   24-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Soybean yellow mottle mosaic virus strain Goesan coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Soybean yellow mottle mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1065
RA   Park S.J., Kim S.M., Nam M., Lee T.S., Kim Y.J., Moon J.K., Kim C.S.,
RA   Choi H.S., Kim H.G., Moon J.S., Lee S.H.;
RT   ;
RL   Submitted (20-NOV-2008) to the EMBL/GenBank/DDBJ databases.
RL   Agricultural Microbiology Division, National Academy of Agricultural
RL   Science, RDA, Suin-ro, 150, Suwon, Gyeongi-do 441-707, Korea
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1065
FT                   /organism="Soybean yellow mottle mosaic virus"
FT                   /host="Glycine soja"
FT                   /strain="Goesan"
FT                   /mol_type="genomic RNA"
FT                   /country="South Korea"
FT                   /collection_date="28-Sep-2007"
FT                   /db_xref="taxon:578361"
FT   gene            1. .1065
FT                   /gene="CP"
FT   CDS             1. .1065
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="ACK77373.1"
FT                   /translation="MNGKMLTIAQLAKKEKSEGRRALSKNQRKRLDSADTRPLKEVSST
FT                   ARVSTRRVPAAISSNVSNGVPNYAVRQNKPVIQHTELWGTLMSNSTESPAYIARTLNPS
FT                   DPATFNWVQPLSTGYDMYRLINCEIIYTPRCATTTTGSVVLAHDPDASDANPDNVTDLL
FT                   NMAGAVSGSVFSPLRIRPNIKQLDRYVRDNSTSDPKLVDAGKILVAAYGQQASTTPFAL
FT                   GEVRFSYTLQLLNPQPHSTMVQRLGAAPPPGVGPTYATLRTVNGATTSSNVLTFSTAGA
FT                   YLITAVDATAGLGTPVTTDFGRFRVQGTSAADSPLLMFGTALKSGATITFSGPVSNVLD
FT                   VSFVRDSGVSDNSS"
XX
SQ   Sequence 1065 BP; 251 A; 317 C; 248 G; 249 T; 0 other;

fj494835 Length: 1065  24-DEC-2008  Type: N  Check: 7858  ..

       1  atgaatggaa agatgctcac cattgcccaa ctcgccaaga aggagaaatc
      51  ggagggacga agagctctct ccaagaacca gcgaaagcga ctcgactccg
     101  ctgacactcg acccctcaaa gaagtcagca gtaccgccag agtgtcaaca
     151  cgaagagtcc ccgctgccat ctcgtccaat gtgtccaatg gagtaccgaa
     201  ctacgctgtt cgacaaaaca aaccggtcat tcagcatact gagctatggg
     251  gaactcttat gtctaatagc actgagtccc ctgcttatat cgctcggaca
     301  ctcaacccaa gtgatcctgc aacattcaat tgggtgcaac cgctctccac
     351  ggggtatgat atgtacagac tcattaattg tgagatcatc tacactccca
     401  ggtgtgcgac taccactacg ggatcggttg tcttggcgca tgatccagac
     451  gctagtgatg ctaaccctga taatgtcact gacctgctta acatggctgg
     501  cgctgtctct ggctcggtct tctctcccct caggatcagg ccaaacatta
     551  aacagctcga ccgttacgtt cgtgacaatt ctactagcga ccccaagctg
     601  gttgatgctg gcaagatatt ggttgcagca tatgggcagc aagcttcaac
     651  cacccccttc gccctcggtg aagtgaggtt ttcatacacg ctccagctgc
     701  tcaaccctca gccacattca actatggttc aacgactcgg ggctgcccca
     751  ccccctgggg tgggccccac ttacgcaacc ttgcgtacag ttaatggtgc
     801  caccacatcc agcaacgttc tcacattttc gactgctggc gcctacctta
     851  ttactgccgt tgacgctaca gctgggctcg gaaccccggt taccactgat
     901  ttcggtcggt tccgcgtaca gggcacgagt gccgcggact ccccactact
     951  aatgttcggc acagctctca agagtggggc tactatcacc tttagtgggc
    1001  ctgtctccaa cgttttagat gtttcttttg tgcgcgatag cggagttagt
    1051  gacaactcca gctag