Sequence of DPV Soybean yellow mottle mosaic virus

Soybean yellow mottle mosaic virus strain Mungyeong1 coat protein (CP) gene, complete cds.

ACC No: FJ494875

Dated: 2008-12-24 | Length: 1065 | CRC: 814576524

                
ID   FJ494875; SV 1; linear; genomic RNA; STD; VRL; 1065 BP.
XX
AC   FJ494875;
XX
DT   24-DEC-2008 (Rel. 98, Created)
DT   24-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Soybean yellow mottle mosaic virus strain Mungyeong1 coat protein (CP)
DE   gene, complete cds.
XX
KW   .
XX
OS   Soybean yellow mottle mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1065
RA   Nam M., Kim S.M., Park S.J., Lee T.S., Kim Y.J., Moon J.K., Kim C.S.,
RA   Choi H.S., Kim H.G., Moon J.S., Lee S.H.;
RT   ;
RL   Submitted (20-NOV-2008) to the EMBL/GenBank/DDBJ databases.
RL   Agricultural Microbiology Division, National Academy of Agricultural
RL   Science, RDA, Suin-ro, 150, Suwon, Gyeongi-do 441-707, Korea
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1065
FT                   /organism="Soybean yellow mottle mosaic virus"
FT                   /host="Glycine soja"
FT                   /strain="Mungyeong1"
FT                   /mol_type="genomic RNA"
FT                   /country="South Korea"
FT                   /collection_date="19-Sep-2007"
FT                   /db_xref="taxon:578361"
FT   gene            1. .1065
FT                   /gene="CP"
FT   CDS             1. .1065
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="ACK77413.1"
FT                   /translation="MNGKMLTIAQLAKKEKTEGRRALSKNQRKRLDSADTRPLKEVSST
FT                   ARVSTRRVPAAISSNVSNGVPNYAVRQNKPVIQHTELWGTLMSNSTESPAYIARTLNPS
FT                   DPATFNWVQPLSTGYDMYRLINCEIIYTPRCATTTTGSVVLAHDPDASDANPDNVTDLL
FT                   NMAGAVSGSVFSPLRIKPNIKQLDRYVRDNSTSDPKLVDAGKILVAAYGQQASTIPFAL
FT                   GEVRFSYTLQLLNPQPHSTMVQRLGAAPPPGVGPTYATLRTVNGATTSSNVLTFSTAGA
FT                   YLITAVDATAGLGTPVTTDFGRFRVQGTSAADSPLLMFGTALKSGATITFSGPVSNVLD
FT                   VYVVRDSGVSDNSS"
XX
SQ   Sequence 1065 BP; 256 A; 312 C; 247 G; 250 T; 0 other;

fj494875 Length: 1065  24-DEC-2008  Type: N  Check: 6655  ..

       1  atgaatggaa aaatgctcac catcgcccaa ctcgccaaga aggagaaaac
      51  agagggacga agagctctct ccaagaacca gcgaaagcga ctcgactccg
     101  ctgacactcg acccctcaag gaagtcagca gcaccgcaag agtgtcaaca
     151  cgaagagtcc ccgctgccat ctcgtccaat gtgtccaatg gagtaccgaa
     201  ctacgctgtt cgacaaaaca aaccggtcat tcagcatact gagctatggg
     251  gaactcttat gtctaatagc actgagtccc ctgcttatat cgctcggaca
     301  ctcaacccaa gtgatcctgc aacattcaat tgggtgcaac cgctctccac
     351  agggtatgat atgtacagac tcattaattg tgagatcatc tacactccca
     401  ggtgtgcgac taccactacg ggatcggttg tcttggcgca tgatccagac
     451  gctagtgatg ctaaccctga taatgtcact gacctgctta acatggctgg
     501  cgctgtctct ggctcggtct tctctcccct caggatcaag ccaaacatta
     551  aacagctcga ccgttatgtt cgtgacaatt ctactagcga ccccaagttg
     601  gttgatgctg gcaagatatt ggttgcagca tatggacagc aagcttcaac
     651  tatccccttc gccctcggtg aagtgaggtt ttcatacacg ctccagctgc
     701  tcaatcctca gccacattca accatggtgc aacgtctcgg ggctgcccca
     751  ccccctgggg tgggtcccac ctacgcaacc ttacgcacag ttaatggtgc
     801  caccacatcc agcaatgttc tcacattttc gactgctggc gcctacctca
     851  ttactgccgt tgacgccaca gctgggctcg gaaccccggt taccactgat
     901  tttggccggt tccgtgtaca gggtaccagt gctgcggact ctccactact
     951  gatgttcggc acagccctca agagtggggc taccattaca tttagtgggc
    1001  ctgtctccaa cgttttggat gtttatgttg tgcgcgatag cggggttagc
    1051  gataactcca gctag