Sequence of DPV Soybean yellow mottle mosaic virus

Soybean yellow mottle mosaic virus strain Seosan coat protein (CP) gene, complete cds.

ACC No: FJ494879

Dated: 2008-12-24 | Length: 1065 | CRC: 962804331

                
ID   FJ494879; SV 1; linear; genomic RNA; STD; VRL; 1065 BP.
XX
AC   FJ494879;
XX
DT   24-DEC-2008 (Rel. 98, Created)
DT   24-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Soybean yellow mottle mosaic virus strain Seosan coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Soybean yellow mottle mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1065
RA   Nam M., Kim S.M., Park S.J., Lee T.S., Kim Y.J., Moon J.K., Kim C.S.,
RA   Choi H.S., Kim H.G., Moon J.S., Lee S.H.;
RT   ;
RL   Submitted (20-NOV-2008) to the EMBL/GenBank/DDBJ databases.
RL   Agricultural Microbiology Division, National Academy of Agricultural
RL   Science, RDA, Suin-ro, 150, Suwon, Gyeongi-do 441-707, Korea
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1065
FT                   /organism="Soybean yellow mottle mosaic virus"
FT                   /host="Glycine soja"
FT                   /strain="Seosan"
FT                   /mol_type="genomic RNA"
FT                   /country="South Korea"
FT                   /collection_date="19-Sep-2007"
FT                   /db_xref="taxon:578361"
FT   gene            1. .1065
FT                   /gene="CP"
FT   CDS             1. .1065
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="ACK77417.1"
FT                   /translation="MNGKMLTIAQLAKKEKTEGRRALSKNQRKRLDSADTRPLKEVSST
FT                   ARVSTRRVPAAISSNVSNGVPNYAVRQNKPVIQHTELWGTLMSNSTESPAYIARTLNPS
FT                   DPATFNWVQPLSTGYDMYRLINCEIIYTPRCATTTTGSVVLAHDPDASDANPDNVTDLL
FT                   NMAGAVSGSVFSPLRIKPNIKQLDRYVRDNSTSDPKLVDAGKILVAAYGQQTSTTPFAL
FT                   GEVRFSYTLQLLNPQPHSTMVQRLGAAPPPGVGPTYATLRTVNGATTSSNVLTFSTAGA
FT                   YLITAVDATAGLGTPVTTDFGRFRVQGTSAADSPLLMFGTALKSGATITFSGPVSNVLD
FT                   VYVVRDSGVSDNSS"
XX
SQ   Sequence 1065 BP; 262 A; 316 C; 245 G; 242 T; 0 other;

fj494879 Length: 1065  24-DEC-2008  Type: N  Check: 2164  ..

       1  atgaatggaa aaatgctcac cattgcccaa ctcgccaaga aggagaaaac
      51  agagggacga agagctctct ccaagaacca gcgaaagcga ctcgactccg
     101  ctgacactcg acccctcaag gaagtcagca gcaccgctag ggtgtcaaca
     151  cgaagagtcc ccgctgccat ctcgtccaat gtgtccaatg gagtaccgaa
     201  ctacgctgtt cgacaaaaca aaccggtcat tcagcatact gagctatggg
     251  gaactcttat gtctaatagc actgagtccc ctgcttatat cgctcggaca
     301  ctcaacccaa gtgatcctgc aacattcaat tgggtacaac cgctctccac
     351  agggtatgat atgtacagac tcattaattg tgagatcatc tacactccca
     401  ggtgtgcgac taccactacg ggatcggttg tcttggcgca tgatccagac
     451  gctagtgatg ctaaccctga taatgtcact gacctgctta acatggctgg
     501  cgctgtctct ggctcggtct tctctcccct caggatcaag ccaaacatta
     551  aacagctcga ccgttatgtt cgtgacaatt ctactagcga ccccaagctg
     601  gttgatgctg gcaagatatt ggttgcagca tatggacagc aaacttcaac
     651  aacccccttc gccctcggcg aagtgaggtt ttcatacacg ctccagctgc
     701  tcaaccctca gccacattca actatggtgc aacgactcgg ggctgcccca
     751  ccccctgggg tgggccccac ttacgcaacc ttgcgaacag ttaatggtgc
     801  caccacatcc agcaatgttc tcacattttc gactgctggc gcctacctca
     851  tcactgccgt tgacgcaaca gctgggctcg gaacaccggt caccactgat
     901  tttggccggt tccgcgtaca gggcactagt gctgcggact ccccactact
     951  gatgttcgga acagccctca agagtggggc taccattacc ttcagtgggc
    1001  ctgtctccaa cgttttggat gtttatgttg tacgcgatag cggagttagc
    1051  gacaactcta gctag