Sequence of DPV Melon necrotic spot virus
Melon necrotic spot virus isolate SP-8 p7A gene, complete cds; p89 gene, partial cds; p7B gene, complete cds; and p42 gene, partial cds.
ACC No: FJ621523
Dated: 2010-03-09 | Length: 387 | CRC: -441693902
ID FJ621523; SV 1; linear; genomic RNA; STD; VRL; 387 BP. XX AC FJ621523; XX DT 22-JUL-2009 (Rel. 101, Created) DT 09-MAR-2010 (Rel. 104, Last updated, Version 2) XX DE Melon necrotic spot virus isolate SP-8 p7A gene, complete cds; p89 gene, DE partial cds; p7B gene, complete cds; and p42 gene, partial cds. XX KW . XX OS Melon necrotic spot virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae; OC Carmovirus. XX RN [1] RP 1-387 RA Herrera-Vasquez J.A., Cordoba-Selles M.C., Cebrian M.C., Rossello J.A., RA Alfaro-Fernandez A., Jorda C.; RT "Genetic diversity of Melon necrotic spot virus and Olpidium isolates from RT different origins"; RL Plant Pathol. 59(2):240-251(2010). XX RN [2] RP 1-387 RA Herrera-Vasquez J.A., Cordoba-Selles Md.C., Cebrian Md.C., Rossello J.A., RA Jorda C.; RT ; RL Submitted (14-JAN-2009) to the EMBL/GenBank/DDBJ databases. RL Ecosistemas Agroforestales, Universidad Politecnica de Valencia, Camino de RL Vera s/n, Valencia, Valencia 46022, Spain XX FH Key Location/Qualifiers FH FT source 1. .387 FT /organism="Melon necrotic spot virus" FT /host="melon" FT /isolate="SP-8" FT /mol_type="genomic RNA" FT /country="Spain:Murcia" FT /collection_date="2008" FT /db_xref="taxon:11987" FT CDS 1. .198 FT /codon_start=1 FT /product="p7A" FT /note="movement protein" FT /db_xref="GOA:C7ATN7" FT /db_xref="InterPro:IPR007982" FT /db_xref="UniProtKB/TrEMBL:C7ATN7" FT /protein_id="ACT53361.1" FT /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKRG FT VMGASTYIADKIKVTINFNF" FT CDS <1. .22 FT /codon_start=2 FT /product="p89" FT /note="putative RNA-dependent RNA polymerase; produced by a FT readthrough of the p29 amber codon" FT /protein_id="ACT53360.1" FT /translation="WTLNEL" FT CDS 202. .387 FT /codon_start=1 FT /product="p7B" FT /note="movement protein" FT /db_xref="InterPro:IPR009575" FT /db_xref="UniProtKB/TrEMBL:C7ATN9" FT /protein_id="ACT53362.1" FT /translation="MACCRCDSSPGDYSGALLVLFISFVFFYITSLSSQGNTYVHHFDN FT SSVKTQYVGISTNGDG" FT CDS 374. .>387 FT /codon_start=1 FT /product="p42" FT /note="coat protein" FT /protein_id="ACT53363.1" FT /translation="MAMV" XX SQ Sequence 387 BP; 114 A; 73 C; 85 G; 115 T; 0 other; fj621523 Length: 387 09-MAR-2010 Type: N Check: 7040 .. 1 atggactctc aacgaactgt agaacaaact aatcctcgtg gaagaagtaa 51 agaacgtggt gacagcgggg gaaaacagaa gaattcaatg gggcgaaaga 101 tagccaatga tgctatctct gaatcgaagc gaggagttat gggtgctagt 151 acatacattg ctgataaaat taaggtgact atcaacttta atttttagtg 201 tatggcttgt tgccgttgcg actccagccc cggggattac tctggagcat 251 tgcttgtatt atttatctca tttgttttct tttatattac ctcgcttagc 301 tcgcaaggaa atacttacgt tcaccacttc gataattctt ccgttaaaac 351 acaatacgtt ggcatctcta caaatggcga tggttaa