Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus isolate SP-8 p7A gene, complete cds; p89 gene, partial cds; p7B gene, complete cds; and p42 gene, partial cds.

ACC No: FJ621523

Dated: 2010-03-09 | Length: 387 | CRC: -441693902

                
ID   FJ621523; SV 1; linear; genomic RNA; STD; VRL; 387 BP.
XX
AC   FJ621523;
XX
DT   22-JUL-2009 (Rel. 101, Created)
DT   09-MAR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Melon necrotic spot virus isolate SP-8 p7A gene, complete cds; p89 gene,
DE   partial cds; p7B gene, complete cds; and p42 gene, partial cds.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-387
RA   Herrera-Vasquez J.A., Cordoba-Selles M.C., Cebrian M.C., Rossello J.A.,
RA   Alfaro-Fernandez A., Jorda C.;
RT   "Genetic diversity of Melon necrotic spot virus and Olpidium isolates from
RT   different origins";
RL   Plant Pathol. 59(2):240-251(2010).
XX
RN   [2]
RP   1-387
RA   Herrera-Vasquez J.A., Cordoba-Selles Md.C., Cebrian Md.C., Rossello J.A.,
RA   Jorda C.;
RT   ;
RL   Submitted (14-JAN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Ecosistemas Agroforestales, Universidad Politecnica de Valencia, Camino de
RL   Vera s/n, Valencia, Valencia 46022, Spain
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .387
FT                   /organism="Melon necrotic spot virus"
FT                   /host="melon"
FT                   /isolate="SP-8"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain:Murcia"
FT                   /collection_date="2008"
FT                   /db_xref="taxon:11987"
FT   CDS             1. .198
FT                   /codon_start=1
FT                   /product="p7A"
FT                   /note="movement protein"
FT                   /db_xref="GOA:C7ATN7"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C7ATN7"
FT                   /protein_id="ACT53361.1"
FT                   /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKRG
FT                   VMGASTYIADKIKVTINFNF"
FT   CDS             <1. .22
FT                   /codon_start=2
FT                   /product="p89"
FT                   /note="putative RNA-dependent RNA polymerase; produced by a
FT                   readthrough of the p29 amber codon"
FT                   /protein_id="ACT53360.1"
FT                   /translation="WTLNEL"
FT   CDS             202. .387
FT                   /codon_start=1
FT                   /product="p7B"
FT                   /note="movement protein"
FT                   /db_xref="InterPro:IPR009575"
FT                   /db_xref="UniProtKB/TrEMBL:C7ATN9"
FT                   /protein_id="ACT53362.1"
FT                   /translation="MACCRCDSSPGDYSGALLVLFISFVFFYITSLSSQGNTYVHHFDN
FT                   SSVKTQYVGISTNGDG"
FT   CDS             374. .>387
FT                   /codon_start=1
FT                   /product="p42"
FT                   /note="coat protein"
FT                   /protein_id="ACT53363.1"
FT                   /translation="MAMV"
XX
SQ   Sequence 387 BP; 114 A; 73 C; 85 G; 115 T; 0 other;

fj621523 Length: 387  09-MAR-2010  Type: N  Check: 7040  ..

       1  atggactctc aacgaactgt agaacaaact aatcctcgtg gaagaagtaa
      51  agaacgtggt gacagcgggg gaaaacagaa gaattcaatg gggcgaaaga
     101  tagccaatga tgctatctct gaatcgaagc gaggagttat gggtgctagt
     151  acatacattg ctgataaaat taaggtgact atcaacttta atttttagtg
     201  tatggcttgt tgccgttgcg actccagccc cggggattac tctggagcat
     251  tgcttgtatt atttatctca tttgttttct tttatattac ctcgcttagc
     301  tcgcaaggaa atacttacgt tcaccacttc gataattctt ccgttaaaac
     351  acaatacgtt ggcatctcta caaatggcga tggttaa