Sequence of DPV Melon necrotic spot virus
Melon necrotic spot virus isolate SP-18 p7A gene, complete cds; p89 gene, partial cds; p7B gene, complete cds; and p42 gene, partial cds.
ACC No: FJ621528
Dated: 2010-03-09 | Length: 387 | CRC: -1966308429
ID FJ621528; SV 1; linear; genomic RNA; STD; VRL; 387 BP.
XX
AC FJ621528;
XX
DT 22-JUL-2009 (Rel. 101, Created)
DT 09-MAR-2010 (Rel. 104, Last updated, Version 2)
XX
DE Melon necrotic spot virus isolate SP-18 p7A gene, complete cds; p89 gene,
DE partial cds; p7B gene, complete cds; and p42 gene, partial cds.
XX
KW .
XX
OS Melon necrotic spot virus
OC Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC Carmovirus.
XX
RN [1]
RP 1-387
RA Herrera-Vasquez J.A., Cordoba-Selles M.C., Cebrian M.C., Rossello J.A.,
RA Alfaro-Fernandez A., Jorda C.;
RT "Genetic diversity of Melon necrotic spot virus and Olpidium isolates from
RT different origins";
RL Plant Pathol. 59(2):240-251(2010).
XX
RN [2]
RP 1-387
RA Herrera-Vasquez J.A., Cordoba-Selles Md.C., Cebrian Md.C., Rossello J.A.,
RA Jorda C.;
RT ;
RL Submitted (14-JAN-2009) to the EMBL/GenBank/DDBJ databases.
RL Ecosistemas Agroforestales, Universidad Politecnica de Valencia, Camino de
RL Vera s/n, Valencia, Valencia 46022, Spain
XX
FH Key Location/Qualifiers
FH
FT source 1. .387
FT /organism="Melon necrotic spot virus"
FT /host="melon"
FT /isolate="SP-18"
FT /mol_type="genomic RNA"
FT /country="Spain:Valencia"
FT /collection_date="2000"
FT /db_xref="taxon:11987"
FT CDS 1. .198
FT /codon_start=1
FT /product="p7A"
FT /note="movement protein"
FT /db_xref="GOA:Q8V993"
FT /db_xref="InterPro:IPR007982"
FT /db_xref="UniProtKB/TrEMBL:Q8V993"
FT /protein_id="ACT53381.1"
FT /translation="MDSQRTVEQTNPRGRSKERGDSGGKQKNSMGRKIANDAISESKQG
FT VMGASTYIADKIKVTINFNF"
FT CDS <1. .22
FT /codon_start=2
FT /product="p89"
FT /note="putative RNA-dependent RNA polymerase; produced by a
FT readthrough of the p29 amber codon"
FT /protein_id="ACT53380.1"
FT /translation="WTLNEL"
FT CDS 202. .387
FT /codon_start=1
FT /product="p7B"
FT /note="movement protein"
FT /db_xref="InterPro:IPR009575"
FT /db_xref="UniProtKB/TrEMBL:C7ATM7"
FT /protein_id="ACT53382.1"
FT /translation="MACCRCDSSPGDYSGALLVLFISFVFFYITSLSPQGNTYVHHFDN
FT SSVKTQYVGISTNGDG"
FT CDS 374. .>387
FT /codon_start=1
FT /product="p42"
FT /note="coat protein"
FT /protein_id="ACT53383.1"
FT /translation="MAMV"
XX
SQ Sequence 387 BP; 115 A; 76 C; 84 G; 112 T; 0 other;
fj621528 Length: 387 09-MAR-2010 Type: N Check: 4830 ..
1 atggactctc aacgaactgt agaacaaact aatcctcgtg gaagaagtaa
51 agaacgtggt gacagcgggg gaaaacagaa gaattcaatg gggcgaaaga
101 tagccaatga tgctatctct gaatcgaagc aaggagttat gggtgctagt
151 acatacattg ctgacaaaat taaggtgact atcaacttta atttttagtg
201 tatggcttgt tgccgttgcg actccagccc cggggattac tctggagcat
251 tgcttgtatt atttatctca tttgttttct tttacattac ctcgcttagc
301 ccgcaaggaa atacttacgt tcaccacttc gataattctt ccgttaaaac
351 acaatacgtt ggcatctcta caaatggcga tggttaa